Latest update: September 24, 2018


ProGT51.2 (Agl16)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT51.2 (Agl16)
Organism Information
Organism NameSulfolobus acidocaldarius
Domain Archaebacteria
PhylumCrenarchaeota
ClassificationFamily: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI)330779
Genome Information
Gene BankCP000077
EMBLCP000077
Gene Information
Gene Nameagl16 
NCBI Gene ID3472645
NCBI Reference SequenceNC_007181.1.
Protein information
Protein NameAgl16 
UniProtKB/ SwissProt IDQ4JAK2
NCBI Ref SeqWP_011277679.1.
UniProtKB Sequence>sp|Q4JAK2|AGL16_SULAC Archaeal glycosylation protein 16 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=agl16 PE=3 SV=1 MYKVWMLTPLFLPVRGGTEVHVFNLSRELVKMSIDVEVHTTRDTYTEREKLIPFEIMDGI KVVRHKRTWIYRDSPSVLHFHNLGRKFSTWNLYTFLFFSLPSVEAPLVMTPHHIFVSDQG RVINWLKRNIGKRVDKLIAVSEWEKEEMINLGYDGSKIVVIPNGVDDMAFNYPKSEGFED YLLYIGRISPEKNQLFAIECIKNLNVKLILIGQVRDKDYLEKIMTRVSELGLEDKVRYLG VVTEEEKYSLMDKSLAVILTSDIEAEGIVIKEAMVRGVPVIVGNKAKVLSTIVKDGVNGF VISSCQDLKDAVEKLRDPKVRKEIGENNISISREWRWRNVSLKVLELYKSLS
EMBL CDSAAY80177.1.
Sequence length352 AA
String330779.Saci_0807.
Glycosylation Information
CAZY FamilyGT4
EC Number (BRENDA)2.4.1.-
Sugar Donor SpecificityUDP-Glc 
Experimental ValidationIn vivo
Donor SpecificityUDP-Glc
Function in Glycosylation pathway1) Agl16 is responsible for the transfers of the terminal glucose residue onto the premature N-glycan of S. acidocaldarius.
Litrature
Year Of Validation2013 
Reference Meyer, B. H., Peyfoon, E., Dietrich, C., Hitchen, P., Dell, A., & Albers, S. V. (2013). Agl16, a thermophilic glycosyltransferase, mediating the last step of the N-glycan biosynthesis in the thermoacidophilic crenarchaeon Sulfolobus acidocaldarius. Journal of bacteriology, JB-00035.

Authors Meyer, B. H., Peyfoon, E., Dietrich, C., Hitchen, P., Dell, A., & Albers, S. V.
Research groupsMolecular Biology of Archaea, Max-Planck Institute for Terrestrial Microbiology, Marburg, Germany.
Corresponding Author Albers, S. V.
ContactsMolecular Biology of Archaea, Max-Planck Institute for Terrestrial Microbiology, Marburg, Germany.