Latest update: September 24, 2018


ProGT51.3 (AglH)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT51.3 (AglH)
Organism Information
Organism NameSulfolobus acidocaldarius
Domain Archaebacteria
PhylumCrenarchaeota
ClassificationFamily: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI)330779
Genome Information
Gene BankCP000077
EMBLCP000077
Gene Information
Gene NameaglH 
NCBI Gene ID3473869
NCBI Reference SequenceNC_007181.1.
Protein information
Protein NameAglH 
UniProtKB/ SwissProt IDP39465
NCBI Ref SeqWP_011277021.1.
UniProtKB Sequence>sp|P39465|GPT_SULAC Putative UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gnpTA PE=3 SV=1 MLVSLLGILLSVIVGFVVTLISTKWVIGLCKKRGFTGKDINKLTKDDVPVLGGIGIVAGF VAGSFTFLLTSYNLSPGIENVVVSILLSSLIIGFLGLLDDIFNISQATRAFLPIFASIPL ILYSVGHTIISIPFLGKVNFGILFYIIILPATLTITANAFNMLEGLNGLGAGMGLIMALA LAYIGLKSGGTSFYAGIVSIILASVLFGFLIFNFYPAKTFPGNIGTYFIGSVIGSIGISG YMYTALFFLYLPYVIEFVLKAKTRFKGVSFGKIDDQGYLHWDSKPNSLTHIVMRIGKFKE YHIVLIIWGIEILFAILAVVFQTVTITI
EMBL CDSBAA05941.1.
Sequence length328 AA
Subcellular LocationMembrane (Integral component of membrane)
String330779.Saci_0093.
Glycosylation Information
Sugar Donor SpecificityUDP-N-acetylglucosamine-1-phosphate 
Acceptor Substrate SpecificityDolichol phosphate
Experimental ValidationIn vivo
Donor SpecificityUDP-N-acetylglucosamine-1-phosphate
Function in Glycosylation pathway1) Glycosyltransferase.
Additional Information1) Complementation studies show that AglH catalyzes the transfers of UDP-N-acetylglucosamine-1-phosphate to dolichol phosphate.  
Litrature
Year Of Validation2017 
Reference Meyer, B. H., Shams-Eldin, H., & Albers, S. V. (2017). AglH, a thermophilic UDP-N-acetylglucosamine-1-phosphate: dolichyl phosphate GlcNAc-1-phosphotransferase initiating protein N-glycosylation pathway in Sulfolobus acidocaldarius, is capable of complementing the eukaryal Alg7. Extremophiles, 21(1), 121-134.

Authors Meyer, B. H., Shams-Eldin, H., & Albers, S. V.
Research groupsMolecular Biology of Archaea, Institute of Biology, University of Freiburg, Schaenzlestrasse 1, 79211, Freiburg, Germany. 
Corresponding Author Albers, S. V.
ContactsMolecular Biology of Archaea, Institute of Biology, University of Freiburg, Schaenzlestrasse 1, 79211, Freiburg, Germany.