Latest update: September 24, 2018


ProGT54.5 (NeuB)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT54.5 (NeuB)
Organism Information
Organism NameAeromonas caviae Sch3N
Domain Bacteria
PhylumProteobacteria
ClassificationFamily: Aeromonadaceae
Order: Aeromonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)648
Genome Information
Gene BankAF126256
EMBLAF126256
Gene Information
Gene NameneuB 
NCBI Reference SequenceAF126256
Protein information
Protein NameNeuB 
UniProtKB/ SwissProt IDQ9R9S2
UniProtKB Sequence>tr|Q9R9S2|Q9R9S2_AERCA NeuB OS=Aeromonas caviae GN=neuB PE=4 SV=1 MDKIIKPFITINGRKIGPDYPPYIIAELSANHNGDINRAFAIMEEAKKAGADAIKLQTYT ADTITFECDSEEFQIHGGLWDGKNLYQLYKEAQMPWEWHQPLFEKAKELGITIFSSPFDF TAVDLLEDLDAPAYKIASFELIDLPLIKRVAQTGKPMIMSTGMANAEEIAEAIATAQSNG CQELVVLHCVSGYPAPADQYNLRTIADMAERFGVLSGLSDHTIDNATAVAAVALGACLIE KHVTMDRNGGGADDSFSLEPHELAALCKDAKTAWSALGSVNYTRTEAEKGNVKFRRSLYV IRDIKAGDVLSNDNVRSIRPGFGLAPKYLEQVLGKTAIVDIKRGTPLSFEFI
EMBL CDSAAD45660.1.
Sequence length352 AA
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Function in Glycosylation pathway1) It is sugar synthetase enzyme.
Additional Information1) Mutation in genes leads to the loss of motility, flagellar expression, and a band for the LPS O-antigen. 
Litrature
Year Of Validation2009 
Reference Tabei, S.M.B., Hitchen, P.G., Day-Williams, M.J., Merino, S., Vart, R., Pang, P.C., Horsburgh, G.J., Viches, S., Wilhelms, M., Tomás, J.M. . & Dell, A. (2009). An Aeromonas caviae genomic island is required for both O-antigen lipopolysaccharide biosynthesis and flagellin glycosylation. Journal of bacteriology, 191(8), 2851-2863.

Authors Tabei, S.M.B., Hitchen, P.G., Day-Williams, M.J., Merino, S., Vart, R., Pang, P.C., Horsburgh, G.J., Viches, S., Wilhelms, M., Tomás, J.M. . & Dell, A.
Research groupsUnit of Infection and Immunity, School of Medicine and Biomedical Sciences, University of Sheffield, Sheffield S10 2RX, United Kingdom.
Corresponding Author Dell, A.
ContactsUnit of Infection and Immunity, School of Medicine and Biomedical Sciences, University of Sheffield, Sheffield S10 2RX, United Kingdom