Latest update: September 24, 2018


ProGT55.1 (PglC)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT55.1 (PglC)
Organism Information
Organism NameAcinetobacter baumannii ATCC 17978
Domain Bacteria
PhylumProteobacteria
ClassificationFamily: Moraxellaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Taxonomic ID (NCBI)400667
Genome Information
Gene BankCP000521
EMBLCP000521
Gene Information
Gene NamepglC 
NCBI Reference SequenceCP000521
Protein information
Protein NamePglC 
NCBI Ref SeqWP_002055229.1
UniProtKB Sequence>WP_002055229.1 UDP-galactose phosphate transferase, partial [Acinetobacter baumannii] MIKFRSMKDAFDAQGNPLPDEARITPFGQKLRSTSLDEMPQLINVLKGDMSVVGPRPMLKDFVALYSPEQ ARRLEVRPGMTGLAQVSGRNELDYEERFKCDVWYVDNHNIWVDFKIMFKTVKVMLKREGINAPGHVGPSL FKGNDTQENIDSSVK
Sequence length155 AA
Glycosylation Information
Function in Glycosylation pathway1) A1S_0061 (PglC) is a glycosyltransferase required in the first step for the synthesis of glycan in A. baumannii.
Additional Information1) Deletion of pglC gene leads to abnormal biofilm structured and attenuated virulence in mice, It also required for capsule formation. 
Litrature
Year Of Validation2013 
Reference Lees?Miller, R. G., Iwashkiw, J. A., Scott, N. E., Seper, A., Vinogradov, E., Schild, S., & Feldman, M. F. (2013). A common pathway for O?linked protein?glycosylation and synthesis of capsule in A cinetobacter baumannii. Molecular microbiology, 89(5), 816-830.

Authors Lees?Miller, R. G., Iwashkiw, J. A., Scott, N. E., Seper, A., Vinogradov, E., Schild, S., & Feldman, M. F.
Research groupsDepartments of Chemistry and Biology, Massachusetts Institute of Technology, Cambridge, Massachusetts 02139, USA.
Corresponding Author Feldman, M. F.
ContactsDepartments of Chemistry and Biology, Massachusetts Institute of Technology, Cambridge, Massachusetts 02139, USA.