Latest update: September 24, 2018


ProGT59.11 (RmlC)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT59.11 (RmlC)
Organism Information
Organism NamePaenibacillus alvei CCM 2051T
Domain Bacteria
PhylumFirmicutes
ClassificationFamily: Paenibacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)44250
Genome Information
Gene BankHM011508
EMBLHM011508
Gene Information
Gene NamermlC 
NCBI Reference SequenceHM011508
Protein information
Protein NameRmlC 
UniProtKB/ SwissProt IDD6QW66
UniProtKB Sequence>tr|D6QW66|D6QW66_PAEAL Putative dTDP-4-dehydrorhamnose 3,5-epimerase OS=Paenibacillus alvei GN=rmlC PE=4 SV=1 MNVKALPLKDAYIIEPVIHGDHRGFFMESYSKKKLNELGIYFNFIQDNQSLSLETGVIRG LHFQLNPKAQTKLIRVISGAIYDVIVDIRKSSSTFGQWVGVILSEHNHRQLLVPKGFAHG FCTLTPNTQVLYKVDEYYSPDHDRGIRWDDPSLGIDWPTSKPILSDKDRLLPVLKEAEIN GFE
EMBL CDSADG29295.1.
Sequence length183 AA
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Additional Information1) Oligosaccharide of the S-layer O-glycan of P. alvei CCM 2051 contains three l-rhamnose residues this indicate that RmlACBD probably provides the nucleotide-activated building block dTDP-l-rhamnose. 
Litrature
Year Of Validation2010 
Reference Zarschler, K., Janesch, B., Pabst, M., Altmann, F., Messner, P., & Schäffer, C. (2010). Protein tyrosine O-glycosylation—a rather unexplored prokaryotic glycosylation system. Glycobiology, 20(6), 787-798.

Authors Zarschler, K., Janesch, B., Pabst, M., Altmann, F., Messner, P., & Schäffer, C.
Research groupsDepartment of NanoBiotechnology, ViennaInstitute of BioTechnology, Universität für Bodenkultur Wien, A-1190 Vienna,Austria.
Corresponding Author Schäffer, C.
ContactsDepartment of NanoBiotechnology, Vienna Institute of BioTechnology, University of Natural Resources and Applied Life Sciences, Vienna, Austria.