Latest update: September 24, 2018


ProGT59.2 (GalU)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT59.2 (GalU)
Organism Information
Organism NamePaenibacillus alvei CCM 2051T
Domain Bacteria
PhylumFirmicutes
ClassificationFamily: Paenibacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)44250
Genome Information
Gene BankHM011508
EMBLHM011508
Gene Information
Gene NameGalU 
NCBI Reference SequenceHM011508
Protein information
Protein NameGalU 
UniProtKB/ SwissProt IDD6QW57
UniProtKB Sequence>tr|D6QW57|D6QW57_PAEAL UTP--glucose-1-phosphate uridylyltransferase OS=Paenibacillus alvei GN=galU PE=3 SV=1 MKIRKAIIPAAGLGTRFIPATKAMPKEMLPIVDKPTIQYIVEEAVDSGIEDIIIVTGKGK RAIEDHFDNYFELEHNLLEKDKLALLEEVRKSSEMANIHYIRQREPRGLGHAIWCARKFV GNEPFAVLLGDDIVQAEKPCLKQMLEVYEQYESSVVGVQPVPWEEVSRYGVIAGNKISER IMKAERLVEKPDKKVAPSNWAIMGRYILTPRIFDLLEQQEIGVNGEIQLTDAIAKLGTLE AIIAYHFEGQRHDVGEKLGFIETTLNYALQRPELKEDLLKFMKEAITKYE
EMBL CDSADG29286.1.
Sequence length290 AA
Glycosylation Information
CAZY FamilyNon-GT
Sugar Donor Specificity UTP 
Acceptor Substrate SpecificityGlucose-1-phosphate
Experimental ValidationIn vivo
ProductUDP-Glc
Donor Specificity UTP
Function in Glycosylation pathway1) GalU is a uridine triphosphate (UTP)-glucose-1-phosphate uridylyltransferase responsible for the transfer of UTP to glucose-1-phosphate to form UDP-glucose.
Litrature
Year Of Validation2010 
Reference Zarschler, K., Janesch, B., Pabst, M., Altmann, F., Messner, P., & Schäffer, C. (2010). Protein tyrosine O-glycosylation—a rather unexplored prokaryotic glycosylation system. Glycobiology, 20(6), 787-798.

Authors Zarschler, K., Janesch, B., Pabst, M., Altmann, F., Messner, P., & Schäffer, C.
Research groupsDepartment of NanoBiotechnology, ViennaInstitute of BioTechnology, Universität für Bodenkultur Wien, A-1190 Vienna,Austria.
Corresponding Author Schäffer, C.
ContactsDepartment of NanoBiotechnology, Vienna Institute of BioTechnology, University of Natural Resources and Applied Life Sciences, Vienna, Austria.