Latest update: September 24, 2018


ProGT59.5 (WsfA)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT59.5 (WsfA)
Organism Information
Organism NamePaenibacillus alvei CCM 2051T
Domain Bacteria
PhylumFirmicutes
ClassificationFamily: Paenibacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)44250
Genome Information
Gene BankHM011508
EMBLHM011508
Gene Information
Gene NamewsfA 
NCBI Reference SequenceHM011508
Protein information
Protein NameWsfA 
UniProtKB/ SwissProt IDD6QW60
UniProtKB Sequence>tr|D6QW60|D6QW60_PAEAL Putative asparagine synthase OS=Paenibacillus alvei GN=wsfA PE=4 SV=1 MCGILFAKSNRITKNEFINSLKIIKYRGPDAPLCFFQHNDFMLGHNRLSIMDLDSRANQP FFSDDQRYVMIYNGEVYNYKELASQYMIEMKTSSDTELILKLYLKIGSSMLNKLNGMFSL IILDTLTNEYFIARDRLGIKPLYYVQQNNELIISSEVAPLLKFTSANLDETAIRQYKKMR NFFNNRTIYKNILEFPPAHFSCNGKISKYWSNNYSEKAPPSDEELKYLIESAVNYRKISD VSVGSYLSGGLDSTIVTALANVNHTWTIGFANENEFKWSKIAADKFGTEHHCISINREEF LETARKLITERKELLTVPNEVLIYFMTLQAKSENSVILSGEGADELFFGYDRIFKWAAAT THWDIKGFNDFYSYGSHDDIEIIEDAINPYLEHQKPISIVASFFQEAHLRGLLRRLDNST MMCSVEARSPFLDFRLVERLSGVSIEYKMENQVVKAPLKRIFKDLLPVEVIERKKIGFPV PLTDIFAGQKAHSVSYDSWFDFNWLCWRETYDYWLYFWSI
EMBL CDSADG29289.1.
Sequence length520 AA
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Additional Information1) It homolog to gene code for asparagine synthetase B (AsnB) but no specific function is known in P. alvei CCM 2051 
Litrature
Year Of Validation2010 
Reference Zarschler, K., Janesch, B., Pabst, M., Altmann, F., Messner, P., & Schäffer, C. (2010). Protein tyrosine O-glycosylation—a rather unexplored prokaryotic glycosylation system. Glycobiology, 20(6), 787-798.

Authors Zarschler, K., Janesch, B., Pabst, M., Altmann, F., Messner, P., & Schäffer, C.
Research groupsDepartment of NanoBiotechnology, ViennaInstitute of BioTechnology, Universität für Bodenkultur Wien, A-1190 Vienna,Austria.
Corresponding Author Schäffer, C.
ContactsDepartment of NanoBiotechnology, Vienna Institute of BioTechnology, University of Natural Resources and Applied Life Sciences, Vienna, Austria.