Latest Update: Feb 22, 2019 (ProGlycProt is registered as partner website of GlyTouCan, the International Glycan Structure Repository)


ProGT59.6 (TagD)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT59.6 (TagD)
Organism Information
Organism NamePaenibacillus alvei CCM 2051T
Domain Bacteria
PhylumFirmicutes
ClassificationFamily: Paenibacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)44250
Genome Information
Gene BankHM011508
EMBLHM011508
Gene Information
Gene NametagD 
NCBI Reference SequenceHM011508
Protein information
Protein NameTagD 
UniProtKB/ SwissProt IDD6QW61
UniProtKB Sequence>tr|D6QW61|D6QW61_PAEAL Putative glycerol-3-phosphate cytidyltransferase OS=Paenibacillus alvei GN=tagD PE=4 SV=1 MIIGYTSGVYDLFHIGHLNLLKNASALCDRLVVGVSTDDLVSYKHKKSVIPFNERMEIVR SIKYVDAVIPQETLDKMEVWRKIKFDVIFVGDDWYENNRWKEYEQQFQEVGVKIIYFPYT KGTSSTLLNETLIKLRNDL
EMBL CDSADG29290.1.
Sequence length139 AA
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Function in Glycosylation pathway1) It is glycerol-3-phosphate cytidyltransferase
Litrature
Year Of Validation2010 
Reference Zarschler, K., Janesch, B., Pabst, M., Altmann, F., Messner, P., & Schäffer, C. (2010). Protein tyrosine O-glycosylation—a rather unexplored prokaryotic glycosylation system. Glycobiology, 20(6), 787-798.

Authors Zarschler, K., Janesch, B., Pabst, M., Altmann, F., Messner, P., & Schäffer, C.
Research groupsDepartment of NanoBiotechnology, ViennaInstitute of BioTechnology, Universität für Bodenkultur Wien, A-1190 Vienna,Austria.
Corresponding Author Schäffer, C.
ContactsDepartment of NanoBiotechnology, Vienna Institute of BioTechnology, University of Natural Resources and Applied Life Sciences, Vienna, Austria.