Latest update: September 24, 2018


ProGT75.1 (Gtf3)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT75.1 (Gtf3)
Organism Information
Organism NameStreptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Domain Bacteria
PhylumFirmicutes
ClassificationFamily: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)170187
Genome Information
Gene BankAE005672
EMBLAE005672
Gene Information
Gene Namegtf3 (SP_1768) 
Protein information
Protein NameGtf3 
UniProtKB/ SwissProt IDA0A0H2UR93
NCBI Ref SeqWP_000766254.1
UniProtKB Sequence>tr|A0A0H2UR93|A0A0H2UR93_STRPN Uncharacterized protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_1768 PE=4 SV=1 MKLHLTNLYGMAGDSTVILAQNAVQKIASQLGFREVGIYFYNIASDSPSEMNKRLDGIMA SISIGDILVFQSPTWNGFEFDRLLFDKLKDMQVKIICFIHDVVPLMFDSNYYLMKDYLYM YNLSDVLIVPSERMKTRLMEEGLTTKKILVQGMWDHPHDLSLYTPAFKKELFFAGSLERF PDLQNWSQDTPLRVFSNKGEASSSARSLSIEGWKKDEELLLELSKGGFGLVWGTHQNEGE SNQYYTLNISHKVSTYLTAGIPVIVPSSLSTAKFIVDQGLGFMADSLEEVHEIVDKMNLQ EYQEMTNRIKTFSYLLKEGYFTKKLLVDAIYHLGID
EMBL CDSAAK75843
Sequence length336 AA
Glycosylation Information
Sugar Donor SpecificityUDP-Glc 
Acceptor Substrate SpecificityGlcNAc-modified SRR
Experimental ValidationIn vivo and In vitro
Donor SpecificityUDP-Glc
Function in Glycosylation pathway1) Gtf3 is responsible for the transfer of Glc residue on to the GlcNAc-modified SRR.
Additional Information1) Gtf3 shows a higher hydrolytic activity toward UDP-Glc compared with UDP-Gal.  
Litrature
Year Of Validation2017 
Reference Jiang, Y. L., Jin, H., Yang, H. B., Zhao, R. L., Wang, S., Chen, Y., & Zhou, C. Z. (2017). Defining the enzymatic pathway for polymorphic O-glycosylation of the pneumococcal serine-rich repeat protein PsrP. The Journal of Biological Chemistry, 292, 6213-6224.

Authors Jiang, Y. L., Jin, H., Yang, H. B., Zhao, R. L., Wang, S., Chen, Y., & Zhou, C. Z.
Research groups1 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China. 2 Key Laboratory of Structural Biology, Chinese Academy of Science, Hefei, Anhui 230027, China. 3 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China. 4 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China
Corresponding AuthorZhou, C. Z.
Contacts1 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China.