Latest update: September 24, 2018


ProGT75.2 (GlyA)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT75.2 (GlyA)
Organism Information
Organism NameStreptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Domain Bacteria
PhylumFirmicutes
ClassificationFamily: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)170187
Genome Information
Gene BankAE005672
EMBLAE005672
Gene Information
Gene NameglyA (SP_1771) 
Protein information
Protein NameGlyA 
UniProtKB/ SwissProt IDA0A0H2URH7
UniProtKB Sequence>tr|A0A0H2URH7|A0A0H2URH7_STRPN Glycosyl transferase, family 2/glycosyl transferase family 8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_1771 PE=4 SV=1 MLVDDKITVIVPVYNVENYLRKCLDSIITQTYKNIEIVVVNDGSTDASGEICKEFSEMDH RILYIEQENAGLSAARNTGLNNMSGNYVTFVDSDDWIEQDYVETLYKKIVEYQADIAVGN YYSFNESEGMFYFHILGDSYYEKVYDNVSIFENLYETQEMKSFALISAWGKLYKARLFEQ LRFDIGKLGEDGYLNQKVYLLSEKVIYLNKSLYAYRIRKGSLSRVWTEKWMHALVDAMSE RITLLANMGYPLEKHLAVYRQMLEVSLANGQASGLSDTATYKEFEMKQRLLNQLSRQEES EKKAIVLAANYGYVDQVLTTIKSICYHNRSIRFYLIHSDFPNEWIKQLNKRLEKFDSEII NCRVTSEQISCYKSDISYTVFLRYFIADFVQEDKALYLDCDLVVTKNLDDLFATDLQDYP LAAVRDFGGRAYFGQEIFNAGVLLVNNAFWKKENMTQKLIDVTNEWHDKVDQADQSILNM LFEHKWLELDFDYNHIVIHKQFADYQLPEGQDYPAIIHYLSHRKPWKDLAAQTYREVWWY YHGLEWTELGQNHHLHPLQRSHIYPIKEPFTCLIYTASDHIEQIETLVQSLPDIQFKIAA RVIVSDRLAQMTIYPNVTIFNGIHYLVDVDNELVETSQVLLDINHGEKTEEILDQFANLG KPILSFENTKTYEVGQEAYAVDQVQAMIEKLREISK
EMBL CDSAAK75845
Sequence length696 AA
Glycosylation Information
Experimental ValidationIn vivo and In vitro
Additional Information1) GlyA performs fourth-step glycosylation of Psrp and also shows higher hydrolytic activity toward UDP-Gal.  
Litrature
Year Of Validation2017 
Reference Jiang, Y. L., Jin, H., Yang, H. B., Zhao, R. L., Wang, S., Chen, Y., & Zhou, C. Z. (2017). Defining the enzymatic pathway for polymorphic O-glycosylation of the pneumococcal serine-rich repeat protein PsrP. The Journal of Biological Chemistry, 292, 6213-6224.

Authors Jiang, Y. L., Jin, H., Yang, H. B., Zhao, R. L., Wang, S., Chen, Y., & Zhou, C. Z.
Research groups1 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China. 2 Key Laboratory of Structural Biology, Chinese Academy of Science, Hefei, Anhui 230027, China. 3 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China. 4 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China
Corresponding AuthorZhou, C. Z.
Contacts1 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China.