Latest update: September 24, 2018


ProGT75.4 (GlyD)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT75.4 (GlyD)
Organism Information
Organism NameStreptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Domain Bacteria
PhylumFirmicutes
ClassificationFamily: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)170187
Genome Information
Gene BankAE005672
EMBLAE005672
Gene Information
Gene NameglyD (SP_1767) 
Protein information
Protein NameGlyD 
UniProtKB/ SwissProt IDA0A0H2URB1
NCBI Ref SeqWP_001044136.1
UniProtKB Sequence>tr|A0A0H2URB1|A0A0H2URB1_STRPN Glycosyl transferase, family 8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_1767 PE=4 SV=1 MNKTIVLAGDRNYTRQLETTIKSILYHNRDVKIYILNQDIMPDWFRKPRKIARMLGSEII DVKLPEQTVFQDWEKQDHISSITYARYFIADYIQEDKVLYLDSDLIVNTSLEKLFSICLE EKSLAAVKDTDGITFNAGVLLINNKKWRQEKLKERLIEQSIVTMKEVEEGRFEHFNGDQT IFNQVLQDDWLELGRAYNLQVGHDIVALYNNWQEHLAFNDKPVVIHFTTYRKPWTTLTAN RYRDLWWEFHDLEWSQILQHHMGEFELISPLDKEFSCLTLTNSQDLEGIEELVTALPEVV FHIAAWTDMGDKLKKLAVYNNVRLHPQIVPPVLDKLKKSTNLYLDINHGSADENFLKSLQ EQEKTLLAFQSTQHGELGQIVFENGKVSFMIDTIKDFKKNGHLTCFRQLPSLTCLTFTAS QYIEQLDYLAGQLPNVVFQIAAWTAMGPKLYDLSNRYPNIQLYPAISRDKLDELKEKMDA YLDINLLTSTSDIVAEMAHLSKPILAFYKSQNGNNGQRLYSSEHPERMLADLQKLITKDM LEKPLDIIQVKGIDETLDYIIEHNSSLVRFGDGEINMLAGHSIPYQDYDEELVSIMRDII GQESREDLVVCLPDAFTDRFRFTSWAIPFWKDHMDHYMDFYRELCSDSWYGSTFVSRPYI DFEDKSQAKAQFEKLKSIWENRDLLIVEGATSRSGVGNDLFDEANSIKRIICPSHSAFSR VHELEQEIEKYAGGRLILCMLGPTAKVLSYNLCQMGYQVLDVGHIDSEYEWMKMGAKTKV KFSHKHTAEHNFDQDIEFIDDETYNSQIVARILN
EMBL CDSAAK75842
Sequence length814 AA
Glycosylation Information
Experimental ValidationIn vivo and In vitro
Additional Information1) GlyD shows a higher hydrolytic activity toward UDP-Glc compared to UDP-Gal.
2) GlyD (DUF1792) but not GlyD (GT8 domain), is responsible for the third-step glycosylation.
3) GlyD, also have galactosyltransferase activity. 
Litrature
Year Of Validation2017 
Reference Jiang, Y. L., Jin, H., Yang, H. B., Zhao, R. L., Wang, S., Chen, Y., & Zhou, C. Z. (2017). Defining the enzymatic pathway for polymorphic O-glycosylation of the pneumococcal serine-rich repeat protein PsrP. The Journal of Biological Chemistry, 292, 6213-6224.

Authors Jiang, Y. L., Jin, H., Yang, H. B., Zhao, R. L., Wang, S., Chen, Y., & Zhou, C. Z.
Research groups1 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China. 2 Key Laboratory of Structural Biology, Chinese Academy of Science, Hefei, Anhui 230027, China. 3 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China. 4 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China
Corresponding AuthorZhou, C. Z.
Contacts1 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China.