Latest update: September 24, 2018


ProGT75.5 (GlyE)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT75.5 (GlyE)
Organism Information
Organism NameStreptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Domain Bacteria
PhylumFirmicutes
ClassificationFamily: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)170187
Genome Information
Gene BankAE005672
EMBLAE005672
Gene Information
Gene NameglyE (SP_1766) 
Protein information
Protein NameGlyE 
UniProtKB/ SwissProt IDA0A0H2URJ6
NCBI Ref SeqWP_001808456.1
UniProtKB Sequence>tr|A0A0H2URJ6|A0A0H2URJ6_STRPN Glycosyl transferase, family 8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_1766 PE=4 SV=1 MRNTKRAVVFAGDYAYIRQIETAMKSLCRHNSHLKIYLLNQDIPQEWFSQIRIYLQEMGG DLIDCKLIGSQFQMNWSNKLPHINHMTFARYFIPDFVTEDKVLYLDSDLIVTGDLTDLFE LDLGENYLAAARSCFGAGVGFNAGVLLINNKKWGSETIRQKLIDLTEKEHENVEEGDQSI LNMLFKDQYSSLEDQYNFQIGYDYGAATFKHQFIFDIPLEPLPLILHYISQDKPWNQFSV GRLREVWWEYSLMDWSVILNEWFSKSVKYPSKSQIFKLQCVNLTNSWCVEKIDYLAEQLP EVHFHIVAYTNMANELLALTRFPNVTVYPNSLPMLLEQIVIASDLYLDLNHDRKLEDAYE FVLKYKKPMIAFDNTCSENLSEISYEGIYPSSIPKKMVAAIRSYMR
EMBL CDSAAK75841
Sequence length406 AA
PDB ID (Structural Information)5GVV, 5GVW
Glycosylation Information
Sugar Donor SpecificityUDP-Gal 
Acceptor Substrate SpecificitySRR1-GlcNAc-Glc-Glc
Experimental ValidationIn vivo and In vitro
ProductSRR1-GlcNAc-Glc-Glc-Gal
Donor SpecificityUDP-Gal
Function in Glycosylation pathway1) GlyE is galactosyltransferase uses UDP-Gal as the donor, SRR1-GlcNAc-Glc-Glc is further modified to produce SRR1-GlcNAc-Glc-Glc-Gal.
Additional Information1) GlyE shows a higher hydrolytic activity toward UDP-Glc compared with UDP-Gal.  
Litrature
Year Of Validation2017 
Reference Jiang, Y. L., Jin, H., Yang, H. B., Zhao, R. L., Wang, S., Chen, Y., & Zhou, C. Z. (2017). Defining the enzymatic pathway for polymorphic O-glycosylation of the pneumococcal serine-rich repeat protein PsrP. The Journal of Biological Chemistry, 292, 6213-6224.

Authors Jiang, Y. L., Jin, H., Yang, H. B., Zhao, R. L., Wang, S., Chen, Y., & Zhou, C. Z.
Research groups1 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China. 2 Key Laboratory of Structural Biology, Chinese Academy of Science, Hefei, Anhui 230027, China. 3 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China. 4 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China
Corresponding AuthorZhou, C. Z.
Contacts1 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China.