Latest update: September 24, 2018


ProGT75.6 (GlyF)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT75.6 (GlyF)
Organism Information
Organism NameStreptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Domain Bacteria
PhylumFirmicutes
ClassificationFamily: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)170187
Genome Information
Gene BankAE005672
EMBLAE005672
Gene Information
Gene NameglyF (SP_1765) 
Protein information
Protein NameGlyF 
UniProtKB/ SwissProt IDA0A0H2URH2
NCBI Ref SeqWP_001232150.1
UniProtKB Sequence>tr|A0A0H2URH2|A0A0H2URH2_STRPN Glycosyl transferase, family 8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_1765 PE=4 SV=1 MRKSIVLAADNAYLIPLETTIKSVLYHNRDVDFYILNSDIAPEWFKLLGRKMEVVNSTIR SVHIDKELFESYKTGPHINYASYFRFFATEVVESDRVLYLDSDIIVTGELATLFEIDLKG YSIGAVDDVYAYEGRKSGFNTGMLLMDVAKWKEHSIVNSLLELAAEQNQVVHLGDQSILN IYFEDNWLALDKTYNYMVGIDIYHLAQECERLDDNPPTIVHYASHDKPWNTYSISRLREL WWVYRDLDWSEIAFQRSDLNYFERSNQSKKQVMLVTWSADIKHLEYLVQRLPDWHFHLAA PCDCSEELTSLSQYTNVTVYQNVLHSRIDWLLDDSIVYLDINTGGEVFNVVTRAQESGKK IFAFDITRKSMDDGLYDGIFSVERPDDLVDRMKNIEIE
EMBL CDSAAK75840
Sequence length398 AA
Glycosylation Information
Experimental ValidationIn vivo and In vitro
Additional Information1) GlyF shows a higher hydrolytic activity toward UDP-Glc compared to UDP-Gal.  
Litrature
Year Of Validation2017 
Reference Jiang, Y. L., Jin, H., Yang, H. B., Zhao, R. L., Wang, S., Chen, Y., & Zhou, C. Z. (2017). Defining the enzymatic pathway for polymorphic O-glycosylation of the pneumococcal serine-rich repeat protein PsrP. The Journal of Biological Chemistry, 292, 6213-6224.

Authors Jiang, Y. L., Jin, H., Yang, H. B., Zhao, R. L., Wang, S., Chen, Y., & Zhou, C. Z.
Research groups1 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China. 2 Key Laboratory of Structural Biology, Chinese Academy of Science, Hefei, Anhui 230027, China. 3 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China. 4 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China
Corresponding AuthorZhou, C. Z.
Contacts1 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China.