Latest update: September 24, 2018


ProGT80.10 (AglD)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT80.10 (AglD)
Organism Information
Organism NameHalobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)64091
Genome Information
Gene BankAE004437
EMBLAE004437
Gene Information
Gene NameaglD 
NCBI Gene ID1447203
NCBI Reference SequenceNC_002607.1.
Protein information
Protein NameAglD 
UniProtKB/ SwissProt IDQ9HSB1
NCBI Ref SeqWP_010902190.1.
UniProtKB Sequence>tr|Q9HSB1|Q9HSB1_HALSA Dolichol-P-glucose synthetase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=dpg PE=4 SV=1 MSETAVEVSVVLPAYNEADTIDATVHTTVETLAGFLPAGSFEVIVAEDGCDDDTPARADA LAAEQSAVRHLHSEQRLGRGGALNAAFDVADGDTLVYFDTDLATDMRHLETLVERVRTGS ADVATGSRWMPGETADRPAKRGIPSRVFNGAVRTLLGSSVRDHQCGFKALSRSAFEALVD DVADEHWFWDTELLVRAQRQGFDVEEFAVDWTPKGDSKVDLVRDVFGMGSQILRCFWEFS VRPYANRRTGLAVGSLLSVVAFALMFVYIDVEAFVDAVANADPVFVAAGAVVYALSWPLR GRRYGDILAELGYREDVWFLTGAVFISQTGNLVIPARAGDAIRAYVVKARRSVPYTTGFA SLAVERVFDLLTITVLAGGVLVALSAFAPSTVTELAATATGDSLTGPASAAVQQATVVST VVGAIAVSTVAVIVWSARTDTNYARRVVAWTSDDSYVELVASVVEQFVGDIQQVAVNGRA FAWIGVSSVVIWTIDVATALLVFVAFGLDLSAVGLVAVGFFAVSVGNLSKVIPGPPGGVG VYEAAFAAIVSTLLPVSFGTAVGIAIVDHIVKNVVTVAGGAVSMMTLNVSLTEAVDGRDA DLVADRESAVGVDD
EMBL CDSAAG18896.1.
Sequence length614 AA
String64091.VNG0318G.
Glycosylation Information
CAZY FamilyGT2
EC Number (BRENDA)2.4.1.-
Experimental ValidationIn vivo
Function in Glycosylation pathway1) Glycosyltransferase.
Additional Information1) aglD gene in Hfx. volcanii can be functionally replaced by their Hbt. Salinarum homolog.
2) It adds the final pentasaccharide hexose in Hfx. volcanii ?aglD cells. 
Litrature
Year Of Validation2015 
Reference Kandiba, L., & Eichler, J. (2015). Deciphering a pathway of Halobacterium salinarum N?glycosylation. MicrobiologyOpen, 4(1), 28-40.

Authors Kandiba, L., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.