Latest update: September 24, 2018


ProGT80.2 (AglP)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT80.2 (AglP)
Organism Information
Organism NameHalobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)64091
Genome Information
Gene BankAE004437
EMBLAE004437
Gene Information
Gene NameaglP 
NCBI Gene ID1447770
NCBI Reference SequenceNC_002607.1.
Protein information
Protein NameAglP 
UniProtKB/ SwissProt IDQ9HQP5
NCBI Ref SeqWP_010902763.1.
UniProtKB Sequence>tr|Q9HQP5|Q9HQP5_HALSA Uncharacterized protein OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_1065C PE=4 SV=1 MAESLLASVSNHFEWRYLQFRYRISSERISRTIGSVESSFHVDTYREFLRVVDYQNEEFV IEALLDTIRSDDVLWDIGANIGTHSCYIGQKAGQTIAIEPFPDNAQRARENCSLNDVDAT VCEYAVGAHEGEATLAVPDTDDNVVGVGTFSLQTDARNAQSVDVDVVPGDQIIQNRGVAL PDVIKIDVEGGEADVLRGFDRGLQNARAVLVEVHPRYVDRDEITRLLESHGFSVSILRQR NDEVHVLATVDDR
EMBL CDSAAG19468.1.
Sequence length253 AA
String64091.VNG1065C.
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Function in Glycosylation pathway1) It is a methyltransferase.
Additional Information1) aglP gene in Hfx. Volcanii can be functionally replaced by their Hbt. Salinarum homolog. 
Litrature
Year Of Validation2015 
Reference Kandiba, L., & Eichler, J. (2015). Deciphering a pathway of Halobacterium salinarum N?glycosylation. MicrobiologyOpen, 4(1), 28-40.

Authors Kandiba, L., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.