Latest update: September 24, 2018


ProGT80.3 (AglQ)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT80.3 (AglQ)
Organism Information
Organism NameHalobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)64091
Genome Information
Gene BankAE004437
EMBLAE004437
Gene Information
Gene NameaglQ 
NCBI Gene ID1447764
NCBI Reference SequenceNC_002607.1.
Protein information
Protein NameAglQ 
UniProtKB/ SwissProt IDQ9HQQ1
NCBI Ref SeqWP_010902757.1.
UniProtKB Sequence>tr|Q9HQQ1|Q9HQQ1_HALSA Uncharacterized protein OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_1058H PE=4 SV=1 MPSSSNRHLTSTHEVIKHCARTGLDSQRADGSFPPGRNYTYDEPETPVRNTANWLRVLTE AYVITGDDAFKRAALASVEYLLTDEVRPHGATYHCRKIQSKDKCNGLVGQASPIRALAKA GTVFDHSDAIETATAVFDLHPYNESLGLWERVEIDGQPLSFDRTLNHQIIFAAAATELAP HRDTVLDRVKRFLSKLESNMRLHENGLIKHYARPPLVPMLREVARSPHYYDMVINECAFH YYSYSKSRRRKERGYQAVNLSALSLLKERVPDHGVWSTDTISRSVDFLRQAQEELIEGID TKHGSLVQATDIAKIRSRFEERPIQCYEELISTDITRTPSRGEGVFELEGINSSTEAALV SVLTDIPNVDLH
EMBL CDSAAG19462.1.
Sequence length357 AA
String64091.VNG1058H.
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Function in Glycosylation pathway1) It is an isomerase.
Additional Information1) aglQ gene in Hfx. volcanii can be functionally replaced by their Hbt. Salinarum homolog. 
Litrature
Year Of Validation2015 
Reference Kandiba, L., & Eichler, J. (2015). Deciphering a pathway of Halobacterium salinarum N?glycosylation. MicrobiologyOpen, 4(1), 28-40.

Authors Kandiba, L., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.