Latest update: September 24, 2018


ProGT80.4 (AglE)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT80.4 (AglE)
Organism Information
Organism NameHalobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)64091
Genome Information
Gene BankAE004437
EMBLAE004437
Gene Information
Gene NameaglE 
NCBI Gene ID1447767
NCBI Reference SequenceNC_002607.1.
Protein information
Protein NameAglE 
UniProtKB/ SwissProt IDQ9HQP8
NCBI Ref SeqWP_010902760.1.
UniProtKB Sequence>tr|Q9HQP8|Q9HQP8_HALSA Rhamnosyl transferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rfbQ PE=4 SV=1 MPDSPFVSVVVPVYNDPEGVKDTLHALVDQRDAPAFEVRVVDNDSTDETMQVIEAFAADH PEIYCHTETEIQSSYAARNTGIEHAGGDVIVFLDADVVVERTCLRDISRTFEGSDVDYVG CNVQMYNPGETDTFWTKYDLAMGLPVEHYLRRKRFAPTCALAVRREVIEAVGTFDDELVS GGDKEFGNRVSEAGFRMGFAEGIVAKHPARTSLKRNIQKSTRIGKGQVQLWAGYGLAAHP VSYTRYLPPDPQRVRNRRDAQFDLVSIYLAEILLKYVQSATVLYLYLKRLLKRVSGDTT
EMBL CDSAAG19465.1.
Sequence length299 AA
String64091.VNG1062G.
Glycosylation Information
CAZY FamilyGT2
EC Number (BRENDA)2.4.1.-
Experimental ValidationIn vivo
Function in Glycosylation pathway1) It is a rhamnosyltransferase.
Additional Information1) aglE gene in Hfx. volcanii can be functionally replaced by their Hbt. Salinarum homolog. 
Litrature
Year Of Validation2015 
Reference Kandiba, L., & Eichler, J. (2015). Deciphering a pathway of Halobacterium salinarum N?glycosylation. MicrobiologyOpen, 4(1), 28-40.

Authors Kandiba, L., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.