Latest Update: Feb 22, 2019 (ProGlycProt is registered as partner website of GlyTouCan, the International Glycan Structure Repository)


ProGT80.5 (AglR)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT80.5 (AglR)
Organism Information
Organism NameHalobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)64091
Genome Information
Gene BankAE004437
EMBLAE004437
Gene Information
Gene NameaglR 
NCBI Gene ID1447760
NCBI Reference SequenceNC_002607.1.
Protein information
Protein NameAglR 
UniProtKB/ SwissProt IDQ9HQQ5
NCBI Ref SeqWP_010902753.1.
UniProtKB Sequence>tr|Q9HQQ5|Q9HQQ5_HALSA Probable transport protein OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=ptp PE=4 SV=1 MRYGRTSIIHFLSRLVMSVSGFFATIALTRILGQRQYGTYVVVLSVLAWTTMAAQFGLPQ AIRKRVSEADGGNYVYAGAILQFLLYVVLAGCLWIARPYITDFVGIDAAPVVIAMLGVRL ALRFVQVVLDGQQLVHVSSLLIPVEWSSRSIVQVSLVVSGVGIAGAFAGYVAGATVAVLV GLYFIDVPRTMPARDEFTSLRSFAQFSWLGSIKSRMFQSMDTLVLAVFVSHSLVAVYEVA WNLASLFAIFGSSIARTLFPEMSGISANSEDTSKIAGLLRVSLAYSGLFIIPGLVGSALV GDIILTIYGDGFRTGYRILLVLTFARLLYGYSRQFLSTIDALDRPKLTLYINVAFVGTNL LLNVLLTWRFGWYGAATATTVSSAISLAGGYYYARRLVNVTVPIGEISRQWLAALLMAGI VVAGRTLVGDSLPAGIVLVAVGGGVYFAALTALSEEFRTTVDDNIPFDIRHRWDG
EMBL CDSAAG19458.1.
Sequence length475 AA
Subcellular LocationMembrane (Integral component of membrane)
String64091.VNG1054G.
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Function in Glycosylation pathway1) It is a flippase.
Additional Information1) aglR gene in Hfx. volcanii can be functionally replaced by their Hbt. Salinarum homolog. 
Litrature
Year Of Validation2015 
Reference Kandiba, L., & Eichler, J. (2015). Deciphering a pathway of Halobacterium salinarum N?glycosylation. MicrobiologyOpen, 4(1), 28-40.

Authors Kandiba, L., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.