Latest update: September 24, 2018


ProGT80.6 (AglF)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT80.6 (AglF)
Organism Information
Organism NameHalobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)64091
Genome Information
Gene BankAE004437
EMBLAE004437
Gene Information
Gene NameaglF 
NCBI Gene ID1447761
NCBI Reference SequenceNC_002607.1
Protein information
Protein NameAglF 
UniProtKB/ SwissProt IDQ9HQQ4
NCBI Ref SeqWP_010902754.1
UniProtKB Sequence>tr|Q9HQQ4|Q9HQQ4_HALSA Glucose-1-phosphate thymidylyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=graD4 PE=4 SV=1 MQAVVLAAGEGTRLRPLTEDKPKGMVEIAGKPILTHCFEQLVALGAEKIVAIVGYRKQNI ISHYGDEFDGVPITYAHQREQNGLAHALLKAEEHVNEDFMLMLGDNIFRANLEDVVNRQQ EERADAAFLVEEVDWDEASRYGVCDTNDYGEIQEVVEKPDDPPSNLVMTGFYTFSPAIFQ ACKLVQPSDRAEYELSDAIDLLIKSGRTIDAIPMEGWRIDVGYPEDRDEAEERIDAVSNE
EMBL CDSAAG19459.1.
Sequence length240 AA
String64091.VNG1055G.
Glycosylation Information
Experimental ValidationIn vivo
Function in Glycosylation pathway1) It has a glucose-1-phosphate thymidylyl transferase activity.
Additional Information1) aglF gene in Hfx. volcanii can be functionally replaced by their Hbt. Salinarum homolog.
2) Able to convert glucose-1-phosphate and UTP into UDP-glucose like its Hfx. volcanii homolog AglF.  
Litrature
Year Of Validation2015 
Reference Kandiba, L., & Eichler, J. (2015). Deciphering a pathway of Halobacterium salinarum N?glycosylation. MicrobiologyOpen, 4(1), 28-40.

Authors Kandiba, L., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.