Latest update: September 24, 2018


ProGT80.7 (AglI)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT80.7 (AglI)
Organism Information
Organism NameHalobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)64091
Genome Information
Gene BankAE004437
EMBLAE004437
Gene Information
Gene NameaglI 
NCBI Gene ID1447771
NCBI Reference SequenceNC_002607.1.
Protein information
Protein NameAglI 
UniProtKB/ SwissProt IDQ9HQP4
NCBI Ref SeqWP_010902764.1.
UniProtKB Sequence>tr|Q9HQP4|Q9HQP4_HALSA Uncharacterized protein OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_1066C PE=4 SV=1 MTDESDSTAHVSCIIPVYNDSVGIKNTLRSVVGQEYHGYDVYVVDNGSTDGSRRRVRNCA AESDDIQLLVEDEVQGSYAARKTGVQNAESDVLAFLDADETVDEDWLETALGAMQEQDVD YLGCNVELTCPEDTLVGRYNARTGFPVEEYLEDQNYAPTCALLVRRKVFEDVGPFDARLI SGGDREFGDRVHDAGYEQGYAENATVYHPARTSLESLAKKNFRVGRGFCQKQRYYPERYG KPGIPPTPSGPSGGDDGDEPDASLTRLAFTLLSIAMLACRGVGYYYEFVVGEENDDIPAP TS
EMBL CDSAAG19469.1.
Sequence length302 AA
String64091.VNG1066C.
Glycosylation Information
CAZY FamilyGT2
EC Number (BRENDA)2.4.1.-
Experimental ValidationIn vivo
Function in Glycosylation pathway1) Glycosyltransferase.
Additional Information1) aglI gene in Hfx. volcanii can be functionally replaced by their Hbt. Salinarum homolog. 
Litrature
Year Of Validation2015 
Reference Kandiba, L., & Eichler, J. (2015). Deciphering a pathway of Halobacterium salinarum N?glycosylation. MicrobiologyOpen, 4(1), 28-40.

Authors Kandiba, L., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.