Latest update: September 24, 2018


ProGT80.9 (AglM)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT80.9 (AglM)
Organism Information
Organism NameHalobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)64091
Genome Information
Gene BankAE004437
EMBLAE004437
Gene Information
Gene NameaglM 
NCBI Gene ID1447756
NCBI Reference SequenceNC_002607.1.
Protein information
Protein NameAglM 
UniProtKB/ SwissProt IDQ9HQQ9
NCBI Ref SeqWP_010902749.1.
UniProtKB Sequence>tr|Q9HQQ9|Q9HQQ9_HALSA UDP-glucose dehydrogenase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=udg1 PE=3 SV=1 MDVSIVGSGYVGTTIAACFAELGHTVVNVDVDADVVAAINDGDAPIHEPGLAERIDAHAG TRLRATTDYEAVRDTDVTFLALPTPAREDGSIDTSIMESGAASLGEALAGADDHMVVVKS TVVPGTTEDVVESALVSAGFDDPLLAMNPEFLRMGSAVDDFRHPDKVVFGARRDAAYDQL HAVFEPLLADAGDATVVETGLREAEMIKYANNAFLASKVSLINDLGNICKELGVDAYEVA DAIAEDDRISGRFLRSGVGWGGSCFPKDVAAITAAAKDAGYEPAMLEAAVEVNDRQPERL LSLLDGHVDVAGERVAVLGLSFKPGTDDIRGTRAVPVIDGLQDREADVVAYDPVAAEKMA EQRPEVTYADSAAGALADAVGAVVVTDWDEFAALDDEFDAMAERVVVDGRRVVDPQADLT YDGLTW
EMBL CDSAAG19454.1.
Sequence length426 AA
String64091.VNG1048G.
Glycosylation Information
CAZY FamilyNon-GT
Acceptor Substrate SpecificityUDP-Glc
Experimental ValidationIn vivo
ProductUDP-glucuronic acid
Function in Glycosylation pathway1) It is a UDP-glucose dehydrogenase.
Additional Information1) aglM gene in Hfx. volcanii can be functionally replaced by their Hbt. Salinarum homolog.
2) It transform UDP-glucose into UDP-glucuronic acid in a NAD(+)-dependent manner.  
Litrature
Year Of Validation2015 
Reference Kandiba, L., & Eichler, J. (2015). Deciphering a pathway of Halobacterium salinarum N?glycosylation. MicrobiologyOpen, 4(1), 28-40.

Authors Kandiba, L., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.