Latest update: September 24, 2018


ProGTNC1 (WbpO)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGTNC1 (WbpO)
Organism Information
Organism NamePseudomonas aeruginosa serotype 06
Domain Bacteria
PhylumProteobacteria
ClassificationFamily: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)287
Genome Information
Gene BankAF498417
EMBLAF498417
Gene Information
Gene NamewbpO 
Protein information
Protein NameWbpO 
UniProtKB/ SwissProt IDQ9RHD7
NCBI Ref SeqWP_012613866.1
UniProtKB Sequence>tr|Q9RHD7|Q9RHD7_PSEAI Vi polysaccharide biosynthesis protein VipA/TviB OS=Pseudomonas aeruginosa OX=287 GN=wbpO PE=3 SV=1 MKDLKVAVVGLGYVGLPLAVEFGKKRTVVGFDINQGRIAELRQGIDSTLEVDAAELKEAS ELSFTFNLQDLQKCNVFIVTVPTPIDEHKQPDLTPLVKASESIGKVLKKGDIVIYESTVY PGATEEDCVPVLEKFSGLRFNEDFFAGYSPERINPGDKEHRVSSIKKVTSGSTPEIAELV DSLYREIITAGTHKASSIKVAEAAKVIENTQRDLNIALINELAIIFNRMGIDTEAVLKAA GTKWNFMPFRPGLVGGHCIGVDPYYLTHKAQSIGYHPEIILAGRRLNDGMGAYVVSQLVK AMLKRRIHVDGARVLLMGLTFKENCPDLRNTKVVDIVRELAEYNIQVDVFDPWVSAEDAM HEYGITPVGTPSHGAYDGIILAVAHSEFKNMGAENIRKLGKAEHVLYDLKYLLDEDKSDL RL
EMBL CDSAAF23997
Sequence length422 AA
Glycosylation Information
Experimental ValidationIn vitro
Function in Glycosylation pathway1) WbpO is NAD(+)/NADP(+) dependent UDP-GalNAc dehydrogenase.
Litrature
Year Of Validation2000 
Reference Zhao X, Creuzenet C, Bélanger M, Egbosimba E, Li J, Lam JS. WbpO, a UDP-N-acetyl-D-galactosamine dehydrogenase from Pseudomonas aeruginosa serotype O6. Journal of Biological Chemistry. 2000 Aug 7.

Authors Zhao X, Creuzenet C, Bélanger M, Egbosimba E, Li J, Lam JS
Research groups1 Department of Microbiology, University of Guelph, Guelph, Ontario N1G 2W1 and the Institute for Biological Sciences, National Research Council, Ottawa, Ontario K1A OR6, Canada.
Corresponding Author Lam JS
Contacts1 Department of Microbiology, University of Guelph, Guelph, Ontario N1G 2W1 and the Institute for Biological Sciences, National Research Council, Ottawa, Ontario K1A OR6, Canada.