Latest update: September 24, 2018


ProGTNC11 (GlmU)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGTNC11 (GlmU)
Organism Information
Organism NameMethanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Meth
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)243232
Genome Information
Gene BankL77117
EMBLL77117
Gene Information
Gene NameglmU 
NCBI Gene ID1451998
Protein information
Protein NameGlmU 
UniProtKB/ SwissProt IDQ58501
NCBI Ref SeqWP_010870613.1
UniProtKB Sequence>sp|Q58501|GLMU_METJA Bifunctional protein GlmU OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=glmU PE=1 SV=1 MDAIILCAGKGERLRPLTENRPKPMIPIAGKPILQHIIEKVEDLVDNIYLIVKYKKEKIV DYFKNHPKIKFLEQGEIDGTGQAVLTAKDYVDDEFLVINGDIIFEDDLEEFLKYKYAVAV KEVKNPENFGVVVLDDENNIIELQEKPENPKSNLINAGIYKFDKKIFELIEKTKISERGE RELTDAIKHLIKEEKVKGIKLNGYWNDVGRPWDILEANKYLLDKINTDIKGKIEENVVIK GEVIIEEGAIVKANSVIEGPAIIKKGAVVGPLAYIRPYTVLMENTFVGNSSEVKASIIMK NTKIPHLSYVGDSIIGENCNFGCNTITANLRFDDKPVKVNIKSKRVESVRKLGVIMGDNV KTGIQVSFMPGVKVGSNCWIGASCLIDRDIESNTFVYKRDELIFRKLK
EMBL CDSAAB99104
Sequence length408 AA
String243232.MJ_1101
Glycosylation Information
Acceptor Substrate SpecificityN-acetyl-alpha-D-glucosamine 1-phosphate
Experimental ValidationIn vitro
ProductUDP-N-acetyl-alpha-D-glucosamine
Function in Glycosylation pathway1) GlmU responsible for the acetylation of GlcN-1-P to GlcNAc-1-P, and for the uridyl transfer from UTP to GlcNAc-1-P, to produce UDP-GlcNAc and pyrophosphate.
Litrature
Year Of Validation2008 
Reference Namboori, S. C., & Graham, D. E. (2008). Acetamido sugar biosynthesis in the Euryarchaea. Journal of bacteriology, 190(8), 2987-2996.

Authors Namboori, S. C., & Graham, D. E.
Research groupsInstitute for Cellular and Molecular Biology, University of Texas at Austin, Austin, Texas 78712, USA
Corresponding Author Graham, D. E.
ContactsInstitute for Cellular and Molecular Biology, University of Texas at Austin, Austin, Texas 78712, USA