Latest update: September 24, 2018


ProGTNC12 (WbpB)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGTNC12 (WbpB)
Organism Information
Organism NameThermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)
Domain Bacteria
PhylumTerrabacteria
ClassificationFamily: Thermaceae
Order: Thermales
Division or phylum: Terrabacteria
Taxonomic ID (NCBI)262724
Genome Information
Gene BankAE017221
EMBLAE017221
Gene Information
Gene NamewbpB 
Protein information
Protein NameWbpB 
UniProtKB/ SwissProt IDQ72KX8
NCBI Ref SeqWP_011172738.1
UniProtKB Sequence>tr|Q72KX8|Q72KX8_THET2 Lipopolysaccaride biosynthesis protein wbpB OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) OX=262724 GN=wbpB PE=1 SV=1 MTRFALTGLAGYIAPRHLKAIKEVGGVLVASLDPATNVGLVDSFFPEAEFFTEPEAFEAY LEDLRDRGEGVDYLSIASPNHLHYPQIRMALRLGANALSEKPLVLWPEEIARLKELEART GRRVYTVLQLRVHPSLLALKERLGQEKGAKDVVLTYVTGRGKWYGKSWKVDEAKSGGLAT NIGIHFFDLLAWLFGRALHVEVHARTPTVNAGYLELEGARVRWFLSIDPSFVPEPLRRQG KRTYRSIAVDGEEVEFSEGFTDLHTEVYRKTLAGEGFGLDEAAEAIRVAALLRTLPLSQP SPENRHPFLG
EMBL CDSAAS80635
String262724.TTC0287
PDB ID (Structural Information)3O9Z, 3OA0
Glycosylation Information
EC Number (BRENDA)1.1.1.335
Litrature
Year Of Validation2010 
Reference Thoden JB, Holden HM. Structural and functional studies of WlbA: A dehydrogenase involved in the biosynthesis of 2, 3-diacetamido-2, 3-dideoxy-D-mannuronic acid. Biochemistry. 2010 Aug 19;49(36):7939-48.

Authors Thoden JB, Holden HM.
Research groups1 Department of Biochemistry, University of Wisconsin, Madison, Wisconsin 53706, USA.
Corresponding AuthorHolden HM.
Contacts1 Department of Biochemistry, University of Wisconsin, Madison, Wisconsin 53706, USA.