Latest update: September 24, 2018


ProGTNC13 (UbiA prenyltransferase)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGTNC13 (UbiA prenyltransferase)
Organism Information
Organism NamePseudomonas aeruginosa PA7
Domain Bacteria
Phylum Proteobacteria
ClassificationFamily: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)38175
Genome Information
Gene BankCP000744
EMBLCP000744
Gene Information
Gene NamePSPA7_6246 
NCBI Reference SequenceCP000744
Protein information
Protein NameUbiA prenyltransferase 
UniProtKB/ SwissProt IDA6VES2
UniProtKB Sequence>tr|A6VES2|A6VES2_PSEA7 UbiA prenyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=PSPA7_6246 PE=4 SV=1 MLRSPPITCRSGPASSPTLPVPATRGQVGMHTTVERSSSLAQLKGLLALMRPRQWVKNAF VVAPLLFSGEFLQVDAVLHALAAVLLFCLASSATYIVNDLHDIERDRLHPKKALTRPLAS GLVSPLQAKYLLALLYLALLGGLLISPPVIMVIGLYLLLNLAYTFFLKHQPVLDIFTIAL GFVLRVYAGAVALAVPVSSWMFVTTLCLALYLAAVKRRQELARNGSQSREVLQHYSLALV DRYAEMSATGALLFYSLFVITSREELVVTIPLVLFGLFRYWYVVEAKEGGESPTDALLSD WQLLATVVLWGLACAYALWPH
EMBL CDSABR82011.1.
Sequence length321 AA
Subcellular LocationMembrane (Integral component of membrane)
Glycosylation Information
Experimental ValidationIn vivo
Additional Information1) Deletion of PSPA7_6246 ( A homolog of M. tuberculosis Rv3806c) gene is involved in D-araf biosynthesis, It deletion also leads to the poor twitching motility, and significantly fewer surface pili than the wild-type even in a retraction-deficient (pilT).  
Litrature
Year Of Validation2011 
Reference Harvey, H., Kus, J. V., Tessier, L., Kelly, J., & Burrows, L. L. (2011). The Pseudomonas aeruginosa D-Arabinofuranose biosynthetic pathway and its role in type IV pilus assembly. Journal of Biological Chemistry, jbc-M111.

Authors Harvey, H., Kus, J. V., Tessier, L., Kelly, J., & Burrows, L. L.
Research groupsInstitute for Infectious Diseases Research and the Department of Biochemistry and Biomedical Sciences, McMaster University, Hamilton, Ontario L8N 3Z5, Canada.
Corresponding Author Burrows, L. L.
ContactsMichael G DeGroote Institute for Infectious Diseases Research and the Department of Biochemistry and Biomedical Sciences, McMaster University, Hamilton, Ontario L8N 3Z5, Canada.