Latest update: September 24, 2018


ProGTNC15 (Short-chain dehydrogenase/red

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGTNC15 (Short-chain dehydrogenase/red
Genome Information
Gene BankCP000744
EMBLCP000744
Gene Information
Gene NamePSPA7_6249 
NCBI Reference SequenceCP000744
Protein information
Protein NameShort-chain dehydrogenase/reductase SDR 
UniProtKB/ SwissProt IDA6VES5
NCBI Ref SeqWP_012078026.1.
UniProtKB Sequence>tr|A6VES5|A6VES5_PSEA7 Short-chain dehydrogenase/reductase SDR OS=Pseudomonas aeruginosa (strain PA7) GN=PSPA7_6249 PE=4 SV=1 MKKILIVGATSAIAEATARRFAAQGATLLLLARDRERLQLLATDLEVRGAAAVHTLGFDA ATNNDYPVLVHSCIETLGGLDQVLIAHGTLSDQKACEQSVDLTLRELTINAFSVIALLTE LAKHFEAQNSGCIAVIGSVAGDRGRQSNYVYGTAKGALSLFLQGLRNRFGKSGVQVLTIK PGFVDTPMTAAFPKGPLWASPEKVAADIEKAIAKGRDVLYTPGFWLPIMVIIRLLPERLF KKLSL
EMBL CDSABR83255.1.
Sequence length245 AA
Subcellular LocationMembrane (Integral component of membrane)