Latest update: September 24, 2018


ProGTNC3 (WbpP)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGTNC3 (WbpP)
Organism Information
Organism NamePseudomonas aeruginosa serotype 06
Domain Bacteria
PhylumProteobacteria
ClassificationFamily: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)287
Genome Information
Gene BankAF498417
EMBLAF498417
Gene Information
Gene NameWbpP 
Protein information
Protein NameWbpP 
UniProtKB/ SwissProt IDQ8KN66
UniProtKB Sequence>tr|Q8KN66|Q8KN66_PSEAI WbpP OS=Pseudomonas aeruginosa OX=287 PE=1 SV=1 MMSRYEELRKELPAQPKVWLITGVAGFIGSNLLETLLKLDQKVVGLDNFATGHQRNLDEV RSLVSEKQWSNFKFIQGDIRNLDDCNNACAGVDYVLHQAALGSVPRSINDPITSNATNID GFLNMLIAARDAKVQSFTYAASSSTYGDHPGLPKVEDTIGKPLSPYAVTKYVNELYADVF SRCYGFSTIGLRYFNVFGRRQDPNGAYAAVIPKWTSSMIQGDDVYINGDGETSRDFCYIE NTVQANLLAATAGLDARNQVYNIAVGGRTSLNQLFFALRDGLAENGVSYHREPVYRDFRE GDVRHSLADISKAAKLLGYAPKYDVSAGVALAMPWYIMFLK
EMBL CDSAAM27817
Sequence length341 AA
PDB ID (Structural Information)1SB8, 1SB9
Glycosylation Information
Experimental ValidationIn vitro
Function in Glycosylation pathway1) WbpP has UDP-GlcNAc C4 epimerase activity
Litrature
Year Of Validation2004 
Reference Ishiyama N, Creuzenet C, Lam JS, Berghuis AM. Crystal structure of WbpP, a genuine UDP-N-acetylglucosamine 4-epimerase from Pseudomonas aeruginosa SUBSTRATE SPECIFICITY IN UDP-HEXOSE 4-EPIMERASES. Journal of Biological Chemistry. 2004 May 21;279(21):22635-42.

Authors Ishiyama N, Creuzenet C, Lam JS, Berghuis AM
Research groupsDepartment of Biochemistry, McGill University, Montreal, Quebec H3A 1A4, Canada.
Corresponding AuthorBerghuis AM
ContactsDepartment of Biochemistry, McGill University, Montreal, Quebec H3A 1A4, Canada.