Latest update: September 24, 2018


ProGTNC4 (PseB)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGTNC4 (PseB)
Organism Information
Organism NameHelicobacter pylori 26695
Domain Bacteria
Phylum Proteobacteria
ClassificationFamily: Helicobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)85962
Genome Information
Gene BankAE000511
EMBLAE000511
Gene Information
Gene NamepseB 
NCBI Gene ID899369
Protein information
Protein NamePseB (HP_0840) 
UniProtKB/ SwissProt IDO25511
NCBI Ref SeqWP_001132631.1
UniProtKB Sequence>sp|O25511|PSEB_HELPY UDP-N-acetylglucosamine 4,6-dehydratase (inverting) OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=pseB PE=1 SV=1 MPNHQNMLDNQTILITGGTGSFGKCFVRKVLDTTNAKKIIVYSRDELKQSEMAMEFNDPR MRFFIGDVRDLERLNYALEGVDICIHAAALKHVPIAEYNPLECIKTNIMGASNVINACLK NAISQVIALSTDKAANPINLYGATKLCSDKLFVSANNFKGSSQTQFSVVRYGNVVGSRGS VVPFFKKLVQNKASEIPITDIRMTRFWITLDEGVSFVLKSLKRMHGGEIFVPKIPSMKMT DLAKALAPNTPTKIIGIRPGEKLHEVMIPKDESHLALEFEDFFIIQPTISFQTPKDYTLT KLHEKGQKVAPDFEYSSHNNNQWLEPDDLLKLL
EMBL CDSAAD07887
Sequence length333 AA
String85962.HP0840
PDB ID (Structural Information)2GN4, 2GN6, 2GN8, 2GN9, 2GNA
Glycosylation Information
Acceptor Substrate SpecificityUDP-GlcNAc
Experimental ValidationIn vitro
ProductUDP-2-acetamido-2,6-dideoxy-alpha-D-xylo-4-hexulose
Function in Glycosylation pathway1) PseB has C6 dehydratase/C5 epimerase activity and involved in first step of the biosynthesis of pseudaminic acid.
Litrature
Year Of Validation2005 
Reference Schoenhofen, I.C., McNally, D.J., Vinogradov, E., Whitfield, D., Young, M., Dick, S., Wakarchuk, W.W., Brisson, J.R. & Logan, S. M. (2005). Functional characterization of dehydratase/aminotransferase pairs from Helicobacter and Campylobacter: enzymes distinguishing the pseudaminic acid and bacillosamine biosynthetic pathways. Journal of Biological Chemistry.

Authors Schoenhofen, I.C., McNally, D.J., Vinogradov, E., Whitfield, D., Young, M., Dick, S., Wakarchuk, W.W., Brisson, J.R. & Logan, S. M.
Research groupsInstitute for Biological Sciences, National Research Council, Ottawa, Ontario K1A OR6, Canada
Corresponding Author Logan, S. M.
ContactsInstitute for Biological Sciences, National Research Council, Ottawa, Ontario K1A OR6, Canada
Reference Ishiyama N, Creuzenet C, Miller WL, Demendi M, Anderson EM, Harauz G, Lam JS, Berghuis AM. Structural studies of FlaA1 from Helicobacter pylori reveal the mechanism for inverting 4, 6-dehydratase activity. Journal of Biological Chemistry. 2006 Aug 25;281(34):24489-95.

Authors Ishiyama N, Creuzenet C, Miller WL, Demendi M, Anderson EM, Harauz G, Lam JS, Berghuis AM
Research groups1 Department of Biochemistry and Department of Microbiology and Immunology, McGill University, Montreal, Quebec.
Corresponding AuthorBerghuis AM
Contacts1 Department of Biochemistry and Department of Microbiology and Immunology, McGill University, Montreal, Quebec.