Latest update: September 24, 2018


ProGTNC5 (PseC)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGTNC5 (PseC)
Organism Information
Organism NameHelicobacter pylori 26695
Domain Bacteria
Phylum Proteobacteria
ClassificationFamily: Helicobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)85962
Genome Information
Gene BankAE000511
EMBLAE000511
Gene Information
Gene NamepseC 
NCBI Gene ID899219
Protein information
Protein NamePseC (HP_0366) 
UniProtKB/ SwissProt IDO25130
NCBI Ref SeqWP_000657303.1
UniProtKB Sequence>sp|O25130|PSEC_HELPY UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=pseC PE=1 SV=1 MKEFAYSEPCLDKEDKKAVLEVLNSKQLTQGKRSLLFEEALCEFLGVKHALVFNSATSAL LTLYRNFSEFSADRNEIITTPISFVATANMLLESGYTPVFAGIKNDGNIDELALEKLINE RTKAIVSVDYAGKSVEVESVQKLCKKHSLSFLSDSSHALGSEYQNKKVGGFALASVFSFH AIKPITTAEGGAVVTNDSELHEKMKLFRSHGMLKKDFFEGEVKSIGHNFRLNEIQSALGL SQLKKAPFLMQKREEAALTYDRIFKDNPYFTPLHPLLKDKSSNHLYPILMHQKFFTCKKL ILESLHKRGILAQVHYKPIYQYQLYQQLFNTAPLKSAEDFYHAEISLPCHANLNLESVQN IAHSVLKTFESFKIE
EMBL CDSAAD07433
Sequence length375 AA
String85962.HP0366
PDB ID (Structural Information)2FN6, 2FNI, 2FNU
Glycosylation Information
EC Number (BRENDA)2.6.1.92
Acceptor Substrate SpecificityUDP-2-acetamido-2,6-dideoxy-beta-L-arabino-4-hexulose
Experimental ValidationIn vitro
ProductUDP-4-amino-4,6-dideoxy-β-l-AltNAc
Function in Glycosylation pathway1) Aminotransferase activity, involved in the second step of the biosynthesis of pseudaminic acid.
Litrature
Year Of Validation2005 
Reference Schoenhofen, I.C., McNally, D.J., Vinogradov, E., Whitfield, D., Young, M., Dick, S., Wakarchuk, W.W., Brisson, J.R. & Logan, S. M. (2005). Functional characterization of dehydratase/aminotransferase pairs from Helicobacter and Campylobacter: enzymes distinguishing the pseudaminic acid and bacillosamine biosynthetic pathways. Journal of Biological Chemistry.

Authors Schoenhofen, I.C., McNally, D.J., Vinogradov, E., Whitfield, D., Young, M., Dick, S., Wakarchuk, W.W., Brisson, J.R. & Logan, S. M.
Research groupsInstitute for Biological Sciences, National Research Council, Ottawa, Ontario K1A OR6, Canada
Corresponding Author Logan, S. M.
ContactsInstitute for Biological Sciences, National Research Council, Ottawa, Ontario K1A OR6, Canada
Reference Schoenhofen IC, Lunin VV, Julien JP, Li Y, Ajamian E, Matte A, Cygler M, Brisson JR, Aubry A, Logan SM, Bhatia S. Structural and functional characterization of PseC, an aminotransferase involved in the biosynthesis of pseudaminic acid, an essential flagellar modification in Helicobacter pylori. Journal of Biological Chemistry. 2006 Mar 31;281(13):8907-16.

Authors Schoenhofen IC, Lunin VV, Julien JP, Li Y, Ajamian E, Matte A, Cygler M, Brisson JR, Aubry A, Logan SM, Bhatia S
Research groups1 Institute for Biological Sciences, National Research Council, Ottawa, Ontario K1A 0R6.
Corresponding AuthorBhatia S
Contacts1 Institute for Biological Sciences, National Research Council, Ottawa, Ontario K1A 0R6.