Latest update: September 24, 2018


ProGTNC6 (PseH)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGTNC6 (PseH)
Organism Information
Organism NameHelicobacter pylori 26695
Domain Bacteria
Phylum Proteobacteria
ClassificationFamily: Helicobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)85962
Genome Information
Gene BankAE000511
EMBLAE000511
Gene Information
Gene NamepseH 
NCBI Gene ID900098
Protein information
Protein NamePseH 
UniProtKB/ SwissProt IDO25094
NCBI Ref SeqWP_000742697.1
UniProtKB Sequence>sp|O25094|PSEH_HELPY UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=pseH PE=1 SV=1 MKKNYSYKNIQAIDFTNLNDGEKLLVLEFRNHPNTALWMYSTFISLKTHLQFIEDLKNSP NHRYFLFKEEGVYLGVGSITKINFFHKHGYLGIYKNPFLKNGGETILKALEFIAFEEFQL HSLHLEVMENNFKAIAFYEKNHYELEGRLKGFISKDKEFIDVLLYYKDKKGYNDQSLLKL
EMBL CDSAAD07394
Sequence length180 AA
String85962.HP0327
PDB ID (Structural Information)4RI1
Glycosylation Information
Experimental ValidationIn vitro
Function in Glycosylation pathway1) PseH mediates N-4 acetylation of UDP-4-amino-4,6-dideoxy-beta-L-AltNAc to form UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose.
Litrature
Year Of Validation2006 
Reference Schoenhofen IC, McNally DJ, Brisson JR, Logan SM. Elucidation of the CMP-pseudaminic acid pathway in Helicobacter pylori: synthesis from UDP-N-acetylglucosamine by a single enzymatic reaction. Glycobiology. 2006 Jun 3;16(9):8C-14C.

Authors Schoenhofen IC, McNally DJ, Brisson JR, Logan SM.
Research groups1 Institute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada.
Corresponding AuthorLogan SM.
Contacts1 Institute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada.