Latest update: September 24, 2018


ProGT100 (PglB)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT100 (PglB)
Organism Information
Organism NameSulfurimonas denitrificans DSM 1251
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Helicobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Phylum: Proteobacteria
Taxonomic ID (NCBI)326298
Genome Information
Gene BankCP000153
EMBLCP000153
Gene Information
Gene NameSuden_1474
Protein information
Protein NamePglB 
UniProtKB/ SwissProt IDQ30QI0
NCBI Ref SeqWP_011373103.1
UniProtKB Sequence>tr|Q30QI0|Q30QI0_SULDN Oligosaccharyl transferase, STT3 subunit OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=Suden_1474 PE=4 SV=1 MLTFTKETKVTLLYIALAFLFSVAIRMIWFYQFVDYEPFRFNAQLMINTNDGYYWAEGAR DILAGVHQDNDLSAVDLAASQLSALFAYILPFSFESVILFMPVFLGSLIVIPIILIAKSI DNLEMGFIAALLASIAHSYYNRTMIGYYDTDMLNIVLPMFLLWSIIWAVRTNQDKYLLIT AVDILIYRWWYPQSYSLESAFFALILLYTLLYERKNSYNYKLLAIMMFAMVGFEGYIRAI FVLIAFYMYKQEKYDRYVHSVLAFSIVLFFVSGGFNPIWEQLSGYVFKDAISVGQEGLKL HFYSVKQTIREAANIPFITFANRISGHVITFLASIIGYIYLVYKHKVMLFGLPLIGLGFL AYVGGLRFTIYAVPVLAFGVAFLISEIARFMPNRRVKVFSMSALTLLILLPNIVHIEAYR VPTVFNADEVKVLDMLRGKANREDYVVAWWDYGYPIRYYSDVKTLIDGGKHRGDVNFPVS FMLTNPQDVSAKLARLDVEYSENSFEDKNPTMFSNIEKMTKEYGFSDTNDFLLSLEGEIE LPKKTRDIYFYLPHRMLDIYPTVEIFSNLDLMNGNMKNRSFFYATKQFRQEQNILNLSQG VVVDLKEFSVNINNNKVPIKRVIQSAYDKNMKFTKEVELVNPNGELNLIFMSSYNTFLVV DEKTYNSVYIQLSVLQEYDKMLFEEVIITPHAKVYKLKI
EMBL CDSABB44751.1
Sequence length699 AA
Subcellular LocationMembrane (Integral component of membrane)
String326298.Suden_1474
Additional Information1) It able to transfer glycans to the acceptor sites, predominantly to the sites having a negatively charged residue in the ?2 position relative to the asparagine.
Glycosyltransferase Information
Glycosylation TypeN- (Asn) linked 
CAZY FamilyGT66
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferEn bloc
Acceptor specificity Sequon_1Asn-Xaa-Ser
Donor TypeLipid linked sugars
Donor SpecificityUndPP-Heptasaccharide
Glycan Information
Glycan transferredHeptasaccharide 
Method of Glycan IndentificationLC-MS
Experimental_strategiesIn vivo and In vitro 
Acceptor Subtrate Information
Acceptor Substrate name scFv13-R4 DQNAT
Acceptor Substrate name TAMRA-GDQNATAF
Acceptor Substrate name AcrA
ProGPdb ID ProGP217
Litrature
Year Of Validation2015 
Reference Ollis, A.A., Chai, Y., Natarajan, A., Perregaux, E., Jaroentomeechai, T., Guarino, C., Smith, J., Zhang, S. & DeLisa, M. P. (2015). Substitute sweeteners: diverse bacterial oligosaccharyltransferases with unique N-glycosylation site preferences. Scientific reports, 5, 15237.

Authors Ollis, A.A., Chai, Y., Natarajan, A., Perregaux, E., Jaroentomeechai, T., Guarino, C., Smith, J., Zhang, S. & DeLisa, M. P.
Research groups1 School of Chemical and Biomolecular Engineering, Cornell University, Ithaca, NY 14853 USA. 2 Department of Microbiology, Cornell University, Ithaca, NY 14853 USA. 3 Comparative Biomedical Sciences, Cornell University, Ithaca, NY 14853 USA. 4 Proteomics and Mass Spectrometry Core Facility, Cornell University, Ithaca, New York.
Corresponding Author DeLisa, M. P.
ContactsProteomics and Mass Spectrometry Core Facility, Cornell University, Ithaca, New York 14853.