Latest update: September 24, 2018


ProGT101 (TtOGT)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT101 (TtOGT)
Organism Information
Organism NameThermobaculum terrenum (strain ATCC BAA-798 / YNP1)
DomainBacteria
PhylumCyanobacteria
ClassificationFamily: Thermomicrobiaceae
Order: Sphaerobacterales
Phylum: Cyanobacteria
Taxonomic ID (NCBI)525904
Genome Information
Gene BankCP001826
EMBLCP001826
Gene Information
Gene NameTter_2822
NCBI Reference SequenceACZ43705
Protein information
Protein NameTtOGT 
UniProtKB/ SwissProt IDD1CIY5
NCBI Ref SeqWP_012876736.1
UniProtKB Sequence>tr|D1CIY5|D1CIY5_THET1 Tetratricopeptide TPR_2 repeat protein OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1) GN=Tter_2822 PE=1 SV=1 MTTRDAATIKALLSHAHEAQRSGDVLASERACWRVLQIAPDNSEALHLLGLLHGECGNYG LAATLLRRAVALDPGEASYHYNLGNVLVASGQVERGITSLHHALELRPDYHRAHSGLYVA LHYSALYDPRARHILALDWARRYADPLTPVPATPVDPDPHRRLRIGYVSGELRCHPVGYF LEPVIEAHDRTAYEVYCYSNDPRSDALTDRLRALSDRWRDVWPLTDAELCELVRRDGIDI LVDLSWHLGMHRLFAFARRPAPVQVTWLAAINTTGMRAMDYLVGDQHLCPPGSDELYTER LVRLSRFYLPCNPPPDLPGWAPADPLGRGFPVFGCFNRLSKIGPEVLDLWAKILLALPRA RLRLIATGLQDPVTSSRLMRALEGRGVAGERLELLSPMPRTDLLATYNDIDVALDTLPYS GCTTSLEALWMGVPVVTLEGADMAGRATSSLLRWAGLQELVSRTQEEYIDIALGLGRDLG TLARLREHLRRWLRSVSMSDQGSFTAELEDAYRRMWRDACQTAAGRQGA
EMBL CDSACZ43705.1
Sequence length529 AA
Subcellular LocationCytoplasmic
String525904.Tter_2822
Additional Information1) When bacterial cells were treated with the OGT inhibitor UDP-5S-GlcNAc, the complete inhibition of T. terrenum growth observed this suggest that OGT is essential for the survival of T. terrenum.
PDB ID 5DJS
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGT41
EC Number (BRENDA) 2.4.1.-
Mechanism of Glycan TransferSequential
Donor TypeNucleotide activated sugars
Donor SpecificityUDP-GlcNAc
Glycan Information
Glycan transferredMonosaccharide (GlcNAc) 
Experimental_strategiesIn vivo and In vitro 
Litrature
Year Of Validation2015 
Reference Ostrowski, A., Gundogdu, M., Ferenbach, A. T., Lebedev, A. A., & van Aalten, D. M. (2015). Evidence for a functional O-GlcNAc system in the thermophilic bacterium Thermobaculum terrenum. Journal of Biological Chemistry, jbc-M115.

Authors Ostrowski, A., Gundogdu, M., Ferenbach, A. T., Lebedev, A. A., & van Aalten, D. M.
Research groupsThe Children’s Hospital of Philadelphia, Philadelphia, Pennsylvania, USA
Corresponding Author van Aalten, D. M.
ContactsThe Children’s Hospital of Philadelphia, Philadelphia, Pennsylvania, USA