Latest update: September 24, 2018


ProGT102 (SO_2329 (EarP)/ Efp-

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT102 (SO_2329 (EarP)/ Efp-
Gene Information
Gene NameSO_2329
NCBI Gene ID1170053
Protein information
Protein NameSO_2329 (EarP)/ Efp-associated protein of unknown  
UniProtKB/ SwissProt IDQ8EEP8
NCBI Ref SeqNP_717919.1
UniProtKB Sequence>tr|Q8EEP8|Q8EEP8_SHEON Uncharacterized protein OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=SO_2329 PE=4 SV=1 MSTSSNASHWDIFCTVVDNYGDIGVTWRLAKQLVNEYHIPIILWVDDLNSFSHILPTLNP KLVSQCFNGVIINHWTTPLAVPYLPGKVLIEAFACELPDEVKLQLATLHKTAPQAVPLWL NLEYLSAEDWVDGCHGLPSMQVSGIKKYFYFPGFTPKTGGLICERELFAERDAWQQDPAN KLQLFESLGLKDIQAQDSVFSIFSYETDSLPALCELWQARAKNDAKIHALLPKGRSLNSL QHLLPCPVDALMPGQQIKLGDLTLHILPMTDQQGFDRLLWSCDVNIVRGEDSFLRAQWAA KPFIWHIYPQEDDYHLIKLEAFIRLYCDNLAPDIADTWSKLNFAFSQGQQSAVKTHWQNL NPVSLPLLQHAKEWPIDAINAADLATRLVQFVKKS
EMBL CDSAAN55363
Sequence length395 AA
Function in Native Organism 1) EarP requires for the posttranslational modification of the conserved R32 of EF-P.
String211586.SO_2329
Potential Application1) Inhibitors targeting EarP type glycosyltransferase helps in the development of specific antibiotics against pathogens.
Additional Information1) EarP is a rhamnosyltransferase and modifies EF-P which indirectly stimulates peptide bond formation.
Glycosyltransferase Information
Glycosylation TypeN- (Arg) linked  
CAZY FamilyGT104
EC Number (BRENDA) 2.4.1.-
Mechanism of Glycan TransferSequential
Donor TypeNucleotide activated sugars
Donor SpecificitydTDP-l-Rhamnose
Glycan Information
Glycan transferredMonosaccharide (Rha) 
Method of Glycan IndentificationLC-MS/MS
Experimental_strategiesIn vivo and In vitro