Latest update: September 24, 2018


ProGT104 (PglLRs)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT104 (PglLRs)
Organism Information
Organism NameRalstonia solanacearum GMI1000
Clinical ImplicationPlant pathogen
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Ralstoniaceae
Order: Burkholderiales
Class: Betaproteobacteria
Phylum: Proteobacteria
Taxonomic ID (NCBI)267608
Genome Information
Gene BankAL646052
EMBLAL646052
Gene Information
Gene NameRsc0559
NCBI Reference SequenceCAD14089
Protein information
Protein NamePglLRs 
UniProtKB/ SwissProt IDQ8Y1X8
UniProtKB Sequence>tr|Q8Y1X8|Q8Y1X8_RALSO Putative lipida core-o-antigen ligase transmembrane protein OS=Ralstonia solanacearum (strain GMI1000) GN=RSc0559 PE=4 SV=1 MLWPVWLATVACWSVPFLVAVHSYPIPTFYSEFVAAIGWVALAAGVLGSTWHSKAGLPKV VLAPLALIGVLIVQLVVATPLNPFFTFAAIVFLLGTVAVCGLGARCRDVPGVLESIAVAV IIGGLLTVAIECLHLFRVSGLPINWISIMPTGAGRRMWGNLNQPNHVATYLAFGLAACLF LGSTRRRYWAPLAAIALALLLGMALTVSRMSWLHLVLVGGVAGLAWSAEERGARRWIRAG VPVLGLAVVYQLCNWLVAYANVLWHLDLPISLDERLQQGVGLRVFLWKHAWHMFLAHPWL GGGWGDYAWNQYVQTDVLGHVEMSMNAHNLVLDLLAKVGVFGLLAVMLPFLGLVHAAWKR RMTPALAFLYAVILVTVAHSMLEYPLHYLYFLLPFAFALGYVDDRKSRVLSPDTAWVLTG IVAICGAVLTGRMWIDYQSVERLYYSLDGPVELQRYQRSGQLLLVPYGNLSIANNAGMTA ETAPIMAAVEHQAVQFYPGSGTVQRWAIALAFQGKTDEALTQVRRLHNQYWIDYAGDSKL LTLVCTKKLEGLATFCARLKAENLVVGVD
EMBL CDSCAD14089.1
Sequence length569 AA
Subcellular LocationMembrane (Integral component of membrane)
Function in Native Organism 1) PglLRs is essential for O-glycosylation.
String267608.RSc0559
Additional Information1) Deletion of gene encoding PglLRs shows complete loss of protein glycosylation, together with a defect in biofilm formation and reduced pathogenicity towards tomato plants.
2) PglLRs can transfer a diNAcBac to a Neisseria protein (DsbA) when co-expressed in E. coli.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
EC Number (BRENDA)2.4.99.18
Mechanism of Glycan TransferEn bloc
Donor TypeLipid linked sugars
Glycan Information
Glycan transferredPentasaccharide (HexNAc-(Pen)-dHex3) and bacillosamine 
Method of Glycan IndentificationLC-MS and MS/MS (HCD and CID)
Experimental_strategiesIn vivo 
Acceptor Subtrate Information
Acceptor Substrate name Putative membrane fusion protein
ProGPdb ID ProGP522
Acceptor Substrate name FtsN
ProGPdb ID ProGP528
Acceptor Substrate name AcrA
ProGPdb ID ProGP529
Acceptor Substrate name Probable tpr domain signal peptide protein
ProGPdb ID ProGP527
Acceptor Substrate name RagB
ProGPdb ID ProGP528
Acceptor Substrate name Hypothetical signal peptide protein
ProGPdb ID ProGP525
Acceptor Substrate name Probable transmembrane protein
ProGPdb ID ProGP522
Acceptor Substrate name Probable lipoprotein transmembrane
ProGPdb ID ProGP523
Acceptor Substrate name Probable peptidase transmembrane protein
ProGPdb ID ProGP522
Acceptor Substrate name FtsL
ProGPdb ID ProGP541
Acceptor Substrate name PilA
ProGPdb ID ProGP539
Acceptor Substrate name Probable transmembrane protein
ProGPdb ID ProGP540
Acceptor Substrate name Peptidyl-prolyl cis-trans isomerase
ProGPdb ID ProGP539
Acceptor Substrate name Probable transmembrane protein
ProGPdb ID ProGP538
Acceptor Substrate name Probable lipoprotein
ProGPdb ID ProGP535
Acceptor Substrate name PilN
ProGPdb ID ProGP534
Acceptor Substrate name Probable m20-related peptidase
ProGPdb ID ProGP533
Acceptor Substrate name Probable serine protease protein
ProGPdb ID ProGP532
Acceptor Substrate name Probable transmembrane protein
ProGPdb ID ProGP531
Acceptor Substrate name D-(−)-3-hydroxybutyrate oligomer hydrolase
ProGPdb ID ProGP530
Acceptor Substrate name PilA
ProGPdb ID ProGP539
Litrature
Year Of Validation2015 
Reference Elhenawy, W., Scott, N. E., Tondo, M. L., Orellano, E. G., Foster, L. J., & Feldman, M. F. (2015). Protein O-linked glycosylation in the plant pathogen Ralstonia solanacearum. Glycobiology, 26(3), 301-311.

Authors Elhenawy, W., Scott, N. E., Tondo, M. L., Orellano, E. G., Foster, L. J., & Feldman, M. F.
Research groups1 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada. 2 Centre for High-Throughput Biology, University of British Columbia, Vancouver, BC, Canada. 3 Faculty of Biochemical and Pharmaceutical Sciences (FBIOYF-UNR), Institute of Molecular and Cellular Biology of Rosario (IBR-CONICET), Rosario, Santa Fe, Argentina. 4 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA.
Corresponding Author Feldman, M. F.
ContactsDepartment of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA