Latest update: September 24, 2018


ProGT105 (SeOGT)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT105 (SeOGT)
Organism Information
Organism NameSynechococcus elongatus PCC 7942
Clinical ImplicationNon-pathogenic
DomainBacteria
PhylumCyanobacteria
ClassificationFamily: Synechococcaceae
Order: Synechococcales
Phylum: Cyanobacteria
Taxonomic ID (NCBI)1140
Genome Information
Gene BankCP000100
EMBLCP000100
Gene Information
Gene NameSynpcc7942_0051
Protein information
Protein NameSeOGT 
UniProtKB/ SwissProt IDQ31S86
NCBI Ref SeqABB56083.1
UniProtKB Sequence>tr|Q31S86|Q31S86_SYNE7 TPR repeat OS=Synechococcus elongatus (strain PCC 7942) GN=Synpcc7942_0051 PE=4 SV=1 MSTQDNSLAENYYQQAIEQWKSRDQKQALQFFKKAVRAKPSNAHYWYALAGTYHIQNKFR AARFCFEKSLNLNPNQDEIKIFLCEICYLLTDYKSVAYYAGQVDLSKIQNLEILYKVACS FKELGQLEKTGQVCSQILSLDDNFWQAKLLAAEILRIKGYSGEAKVLVLELIDQQPTVGK FWNELGINEVDLAHEDEALSAFSKAEQYVSGPEKLIIGSNYLFEFSSGLRTAKDILDAHL LWNKKYCKDQGGSFQSSKFNYLKSNDKKNIAYLSGDFKTHSVSYFIEGILENHSRDAFNI ILLSNTQEDEKTKKFKELADIWIDLKLTNFETAAQIVKRLNIDILIELSGHTNGNKLNLL SSRLAPVQATYLGYFATTGLSTIDYWITDNVVHPAHTVELATETIFRLPRCYLAYTPPPQ SPSIAESPVIKNGYITFGSFVASRKISDYSILLWSSILSEIPNSQLLIKNRSCVSPLYRS ELIEKFSLCGISSQRINFNEAKLNLEDHLALYNKVDIALDTYPASGCTTTVEALWMGVPV LTRLGELMVSRNSASLLHALNLQNWIAETDEEYIDKGIKFTQSIEQLALLRQGMRERFMQ SELYDSRGLTLHLEDFYLKALQEKLSANKEVRF
EMBL CDSABB56083.1
Sequence length633 AA
Additional Information1) SeOGT is an O-GlcNAc transferase which shows an active-site homology and similar domain structure to eukaryotic OGTs.
2) The deletion mutant cells of OGT show increase in free inorganic phosphate levels, change in shape of thylakoid lumen.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGT41
EC Number (BRENDA)2.4.1.-
Donor TypeNucleotide activated sugars
Donor SpecificityUDP-GlcNAc
Glycan Information
Glycan transferredMonosaccharide (GlcNAc) 
Experimental_strategiesIn vivo 
Litrature
Year Of Validation2015 
Reference Sokol, K. A., & Olszewski, N. (2014). The putative eukaryotic-like O-GlcNAc transferase of the cyanobacterium Synechococcus elongatus PCC7942 hydrolyzes UDP-GlcNAc and is involved in multiple cellular processes. Journal of bacteriology, JB-01948.

Authors Sokol, K. A., & Olszewski, N.
Research groups1 Department of Genetics, Cell Biology, and Development, University of Minnesota, Saint Paul, Minnesota, USA 2. Department of Plant Biology, University of Minnesota, Saint Paul, Minnesota, USA
Corresponding Author Olszewski, N.
ContactsDepartment of Plant Biology, University of Minnesota, Saint Paul, Minnesota, USA