Latest update: September 24, 2018


ProGT113 (Gtf1)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT113 (Gtf1)
Organism Information
Organism NameStreptococcus gordonii
Clinical ImplicationPathogenic
DomainBacteria
PhylumFirmicutes
ClassificationFamily: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)1302
Genome Information
Gene BankAY028381
EMBLAY028381
Gene Information
Gene Namegtf1
Protein information
Protein NameGtf1 
UniProtKB/ SwissProt IDQ9AET5
UniProtKB Sequence>sp|Q9AET5|GTF1_STRGN Glycosyltransferase Gtf1 OS=Streptococcus gordonii GN=gtf1 PE=1 SV=2 MTVYNINLGIGWASSGVEYAQAYRAQILRRIQQPAKFIFMDMILADNIQHLTENIGFLDE EIIWLYNYFTDIKIAPTTVTLDQVLAQVAGQPERSEKEGKIVRYFYPQDDQFITCYLRQE DQDSVEHVEYVSRGRLIRKDYFSYVRYASEYFAPHNDAATLYQRRFYHEDGSVAYDMLIE DGQEKLYRFPDRIFYSKAELVRYFLQCLQLQADDVVILDRETGIGQVVFEESQKAKLGVV VHAEHFSENASSDDYILWNNFYDYQFTNADKVDFFIVATEAQKRILEQQFQHYSDKQPQI ATIPVGSLDQLTYPKEPRKPYSMITASRLATEKHIDWLVAATVQAHAQLPELTLDIYGKG SEEDKLRRRIEEAGAQDYIRLKGHADLSQIYAGYELYLTASTSEGFGLTLMEAVGSGLPL IGFDVRYGNQTFIDDGKNGYLLPVSSNHVEDQIIAAFVEKIIALFSQGRQQEMSQHSYQV AENYLTSRVEAAWTQLLKEVRDDSAL
EMBL CDSAAK17002
Sequence length506 AA
Subcellular LocationMembrane (Integral component of membrane)
Function in Native Organism 1) Deletion of GtfA abolishes adhesin secretion in Streptococcus gordonii.
Additional Information1) GtfA made a complex with GtfB and together both required for modification of Ser/Thr-rich repeats of adhesin in S. gordonii.
2) Only GtfA contains an active site for glycosylation.
PDB ID 5E9T 5E9U
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGT4
EC Number (BRENDA)2.4.99.18
Mechanism of Glycan TransferSequential
Donor TypeNucleotide activated sugars
Donor SpecificityUDP-GlcNAc
Glycan Information
Glycan transferredMonosaccharide (GlcNAc) 
Experimental_strategiesIn vivo and In vitro 
Acceptor Subtrate Information
Acceptor Substrate name GspB
ProGPdb ID ProGP229
Litrature
Year Of Validation2016 
Reference Chen, Y., Seepersaud, R., Bensing, B. A., Sullam, P. M., & Rapoport, T. A. (2016). Mechanism of a cytosolic O-glycosyltransferase essential for the synthesis of a bacterial adhesion protein. Proceedings of the National Academy of Sciences, 113(9), E1190-E1199.

Authors Chen, Y., Seepersaud, R., Bensing, B. A., Sullam, P. M., & Rapoport, T. A.
Research groups1 Howard Hughes Medical Institute, Harvard Medical School, Boston, MA 02115; Department of Cell Biology, Harvard Medical School, Boston. 2 San Francisco Veteran Affairs Medical Center, San Francisco, CA 94121; University of California, San Francisco.
Corresponding Author Rapoport, T. A.
Contacts1 Howard Hughes Medical Institute, Harvard Medical School, Boston, MA 02115. 2 Department of Cell Biology, Harvard Medical School, Boston.