Latest update: September 24, 2018


ProGT115 (GT1)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT115 (GT1)
ProGT Pathway
Organism Information
Organism NameClostridium difficile R20291
Clinical ImplicationPathogenic
DomainBacteria
PhylumFirmicutes
ClassificationFamily: Clostridiaceae
Order: Clostridiales
Class: Clostridia
Phylum: Firmicutes
Taxonomic ID (NCBI)645463
Genome Information
Gene BankFN545816
EMBLFN545816
Gene Information
Gene NameCDR20291_0241
Protein information
Protein NameGT1 
UniProtKB/ SwissProt IDC9YI48
NCBI Ref SeqCBE01877
UniProtKB Sequence>tr|C9YI48|C9YI48_PEPDR Putative glycosyltransferase OS=Peptoclostridium difficile (strain R20291) GN=CDR20291_0241 PE=4 SV=1 MDIEERVRLCFTPFFFYKYTFERKIYMLLSIVMIVKNEEKILEKTLKSLTTLRSSIESEL IIVDTGSTDDTINISRKYTENVYFHNWNNDFSSMRNISISYAKGEWLLILDADEILIDSS TIVKFFKDGLDKKFNSASIQLKNLYSYDKKLYGYCSVLRLFKNIDFRYHGKVHEQPIYKN PIFNNVADFEHYGYLFEDEEIRLNKVKRNEKLLFEELKENDNSPYTNYQLGKNFIILGKY HEALYYLEKSYELYSKLESAPGYLITSLVKTYLYLGKHKKCEKLCLKYIKKDMNNIDIYY YIAQAQVDLGKYENSIDSYKRYIYLLDNYEISTQANSLFSDTDTVGLRDEAIITLIKIYY KLEKYESVISEYNNIEDMEKKKNVYFSLFMSLYKLNRFEDIKNYYKEVSNSKIEKNSFYK NIEEVINNIKDDEKEHVYKILCDIEGNYGILNQIRINKCVSIDKCKEILNEEKEIIYAYI IKVAFEDKIDLLDIFYEMEYVWIEKYLKYLLALERSFNLVLYKYIISRPNTSDIKKIRVY KAISKVVLESISLSDEKYKEIFYLYIMYSYKYIRYIYRNLSDFELIKFVCNDLDKFTIEF KHLLDIKNKVNDANEKLEYIHSMRKLLNEYPFYNKIIKILISELEENIKESEEFKDLKDS FIISIENMIETGKINDAKSLVDDYSKTFMDDVKILNIKGILYMFENKLDKADFMLKKALS LDVENEDTIYNIEYLKSLR
EMBL CDSCBE01877.1
Sequence length739 AA
Function in Native Organism 1) GT1 transfer GlcNAc to the flagella.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGT2
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferSequential
Donor TypeNucleotide activated sugars
Donor SpecificityUDP-GlcNAc
Accessory GT IDProGT115.1 ProGT115.2
Glycan Information
Glycan transferredMonosaccharide (GlcNAc) 
Method of Glycan IndentificationNano-LC-MS/MS
Experimental_strategiesIn vivo 
Acceptor Subtrate Information
Acceptor Substrate name FliC
ProGPdb ID ProGP298
Litrature
Year Of Validation2016 
Reference Valiente, E., Bouché, L., Hitchen, P., Faulds-Pain, A., Songane, M., Dawson, L.F., Donahue, E., Stabler, R.A., Panico, M., Morris, H.R. & Bajaj-Elliott, M. (2016). Role of glycosyltransferases modifying type B flagellin of emerging hypervirulent Clostridium difficile lineages and their impact on motility and biofilm formation. Journal of Biological Chemistry, jbc-M116.

Authors Valiente, E., Bouché, L., Hitchen, P., Faulds-Pain, A., Songane, M., Dawson, L.F., Donahue, E., Stabler, R.A., Panico, M., Morris, H.R. & Bajaj-Elliott, M.
Research groups1 Department of Pathogen Molecular Biology, London School of Hygiene and Tropical Medicine, Keppel Street, London WC1E 7HT, United Kingdom. 2 Department of Life Sciences, Imperial College London, South Kensington Campus, London SW7 2AZ, United Kingdom. 3 Institute of Child Health, University College London, 30 Guilford Street, London WC1N 1EH, United Kingdom. 4 BioPharmaSpec Ltd., Suite 3.1, Lido Medical Centre, St. Saviours Road, Jersey JE2 7LA, United Kingdom. 5 Vaccine Program, Human Health Therapeutics Portfolio, National Research Council, Ottawa, Ontario K1A 0R6, Canada.
Corresponding Author Bajaj-Elliott, M.
ContactsDepartment of Pathogen Molecular Biology, London School of Hygiene and Tropical Medicine, Keppel Street, London WC1E 7HT, United Kingdom.