Latest update: September 24, 2018


ProGT117 (GT)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT117 (GT)
Organism Information
Organism NameStreptococcus sanguinis (strain SK36)
Clinical ImplicationPathogenic
DomainBacteria
PhylumFirmicutes
ClassificationFamily: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)388919
Genome Information
Gene BankCP000387
EMBLCP000387
Gene Information
Gene NameSSA_0830
NCBI Gene ID4806104
Protein information
Protein NameGlycosyltransferase, putative 
UniProtKB/ SwissProt IDA3CM53
NCBI Ref SeqWP_011836740.1
UniProtKB Sequence>tr|A3CM53|A3CM53_STRSV Glycosyltransferase, putative OS=Streptococcus sanguinis (strain SK36) OX=388919 GN=SSA_0830 PE=1 SV=1 MKTIVLVGDQAYQEQVSTTIKSILYYNKNVKIYVFNQGLSDEWFRDFNELVEQLDSELVN ISLDQVTISPEWLTQDHISSATYARYFIPQFVAEGRVLYLDSDLVVNRDLQPLFDIPLEG KLVAAVGDAGGYGFNAGVLLIDNRSWKERELQESFIKETDRIMGLVQSGQMEDFNGDQTV LNHVLAQDWLPLDKIYNLQVGHDLVAFYSGWNGHFELDQEPLIIHYTTFRKPWNSEVSYR YRQLWWDFQALSLEEILAHHRGEFEMPDRWEKAALNCMLLTDVQELEQIEFLAQSLPRVD FHIACYTEMGAYLQSLNQYENIHLYPQVIHAVLDELIDKCQVYLDIHHGSEHYELSSRFK ALGKPVLAFDNTKKNEKEELVYPHEHPQEMVRKLRSLMKKEKPQAFRAVVLAANAAYSEQ VLTTIKSIVCHNRFIKFYVINSDFPTEWFVSMRKKLAKLDCQIVNARVDGSHISQYKTNI HYSVFLRYFTATFVEEDQALYLDCDIVVTRDLSEIFAVDLGSYPLGAVRDLGGEVYFGEQ IFNSGVLLINVNYWRENDIAGQLIEMTDNLHDKVTQDDQSILNMLFENRWMELPFAYNCI TLHTTFSDYEPEKGLYPPVIHYLTERKPWKEYTQSIYREVWWFYQGLDWSDMQEPVGALT QKMVEGEDGPSLSCLVYTYSCDLMHINYLIQALPACHFYIAAPVVVAEPITRLLQYPNVS VSSDIAGIPALLESLEAKSQLLLDINAGDEVGDIIARFKSAGKPVFAFDSTVHGQQGQEV FPADNPEVMVQAIEKLGLAEPEERQISVLSINQSLDYLLEKGASVVRFGDGEMDLVAGRS IVYQDFDPELSARLREIMSMESDERLMVCLPDVFTGLERYSIDAQNFWSLNHLPHFLEKY KNICRAPWYGSTFISRPYIDLEDKTPSVGYFAKLKQLWQDKDLLIVEGLTSRSGVGNDLF DGARSIKRIICPSRNAYSKLEAIKQAVREHADNRLILTMLGPTAKVLVYDLVQEGYRALD IGHIDSEYEWFQMGASHKVKLSHKHTAEHNFDQDIEFRDDQAYDSQIVANLAQE
EMBL CDSABN44258.1
Sequence length1074 AA
String388919.SSA_0830
PDB ID 5V4A
Glycosyltransferase Information
CAZY FamilyGT8
Glycan Information
Litrature
Year Of Validation2017 
Reference Zhang, H., Zhu, F., Yang, T., Ding, L., Zhou, M., Li, J., Haslam, S.M., Dell, A., Erlandsen, H. & Wu, H. (2014). The highly conserved domain of unknown function 1792 has a distinct glycosyltransferase fold. Nature communications, 5, 4339.

Authors Zhang, H., Zhu, F., Yang, T., Ding, L., Zhou, M., Li, J., Haslam, S.M., Dell, A., Erlandsen, H. & Wu, H.
Corresponding Author Wu, H.