Latest update: September 24, 2018


ProGT12 (Rv1002c)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT12 (Rv1002c)
ProGT Pathway
Organism Information
Organism NameMycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Clinical ImplicationPathogenic
DomainBacteria
PhylumActinobacteria
ClassificationFamily: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI)83332
Genome Information
Gene BankAL123456
EMBLAL123456
Gene Information
Gene Namepmt
NCBI Gene ID887882
Protein information
Protein NameRv1002c 
UniProtKB/ SwissProt IDP9WN05
NCBI Ref SeqNP_215518.1
UniProtKB Sequence>sp|P9WN05|PMT_MYCTU Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pmt PE=1 SV=2 MTARPPESCVLAKDRPEEPVVPVVSPGPLVPVADFGPLDRLRGWIVTGLITLLATVTRFL NLGSLTDAGTPIFDEKHYAPQAWQVLNNHGVEDNPGYGLVVHPPVGKQLIAIGEAIFGYN GFGWRFTGALLGVVLVALVVRIVRRISRSTLVGAIAGVLLICDGVSFVTARTALLDGFLT FFVVAAFGALIVDRDQVRERMHIALLAGRSAATVWGPRVGVRWWRFGAGVLLGLACATKW SGVYFVLFFGAMALAFDVAARRQYQVQRPWLGTVRRDVLPSGYALGLIPFAVYLATYAPW FASETAIDRHAVGQAVGRNSVVPLPDAVRSLWHYTAKAFHFHAGLTNSAGNYHPWESKPW TWPMSLRPVLYAIDQQDVAGCGAQSCVKAEMLVGTPAMWWLAVPVLAYAGWRMFVRRDWR YAVVLVGYCAGWLPWFADIDRQMYFFYAATMAPFLVMGISLVLGDILYHPGQGSERRTLG LIVVCCYVALVVTNFAWLYPVLTGLPISQQTWNLEIWLPSWR
EMBL CDSCCP43752.1
Sequence length503 AA
Subcellular LocationMembrane
Function in Native Organism 1) Rv1002c is O-mannosyltransferase transfer the mannose to the alanine proline-rich protein Apa.
String83332.Rv1002c.
Potential Application1) O-mannosylated and other glycoproteins are present on the cell surface of M. TB and are involved in interaction with host cell during infection, this protein glycosyltransferase may be useful in designing of novel drug targets.
Additional Information1) Mycobacterial protein O-mannosylation occurs by a similar mechanism to that in eukaryotes.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGT39
EC Number (BRENDA)2.4.1.-
Donor TypeLipid linked sugars
Donor SpecificityPolyprenol phosphate-Mannose
Accessory GT IDProGT12.1
Glycan Information
Glycan transferredMonosaccharide (Man) 
Method of Glycan IndentificationLC-ESI-MS/MS
Acceptor Subtrate Information
Acceptor Substrate name Apa
ProGPdb ID ProGP51
Acceptor Substrate name SodC
ProGPdb ID ProGP189
Litrature
Year Of Validation2005 
Reference VanderVen, B. C., Harder, J. D., Crick, D. C., & Belisle, J. T. (2005). Export-mediated assembly of mycobacterial glycoproteins parallels eukaryotic pathways. Science, 309(5736), 941-943.

Authors VanderVen, B. C., Harder, J. D., Crick, D. C., & Belisle, J. T.
Research groupsMycobacteria Research Laboratories, Department of Microbiology, Immunology, and Pathology, Colorado State University, Fort Collins, CO 80523-1682, USA.
Corresponding Author Belisle, J. T.
ContactsMycobacteria Research Laboratories, Department of Microbiology, Immunology, and Pathology, Colorado State University, Fort Collins, CO 80523-1682, USA.
Reference Liu, C.F., Tonini, L., Malaga, W., Beau, M., Stella, A., Bouyssié, D., Jackson, M.C., Nigou, J., Puzo, G., Guilhot, C. & Burlet-Schiltz, O.(2013). Bacterial protein-O-mannosylating enzyme is crucial for virulence of Mycobacterium tuberculosis. Proceedings of the National Academy of Sciences, p.201219704.

Authors Liu, C.F., Tonini, L., Malaga, W., Beau, M., Stella, A., Bouyssié, D., Jackson, M.C., Nigou, J., Puzo, G., Guilhot, C. & Burlet-Schiltz, O.
Research groupsScientific Research National Center, Institute of Pharmacology and Structural Biology, F-31077 Toulouse, France.
Corresponding Author Burlet-Schiltz, O.
ContactsScientific Research National Center, Institute of Pharmacology and Structural Biology, F-31077 Toulouse, France.
Reference Córdova-Dávalos, L. E., Espitia, C., González-Cerón, G., Arreguín-Espinosa, R., Soberón-Chávez, G., & Servín-González, L. (2014). Lipoprotein N-acyl transferase (Lnt1) is dispensable for protein O-mannosylation by Streptomyces coelicolor. FEMS microbiology letters, 350(1), 72-82.

Authors Córdova-Dávalos, L. E., Espitia, C., González-Cerón, G., Arreguín-Espinosa, R., Soberón-Chávez, G., & Servín-González, L.
Research groupsDepartment of Molecular Biology and Biotechnology, Institute of Biomedical Research, National Autonomous University of Mexico, Ciudad Universitaria, Mexico City, Mexico City.
Corresponding Author Servín-González, L.
ContactsDepartment of Molecular Biology and Biotechnology, Institute of Biomedical Research, National Autonomous University of Mexico, Ciudad Universitaria, Mexico City, Mexico City.