Latest update: September 24, 2018


ProGT13 (AglB)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT13 (AglB)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Clinical ImplicationNon-pathogenic
DomainArchaebacteria
PhylumEuryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene NameMMP1424
NCBI Gene ID2761329
Protein information
Protein NameAglB 
UniProtKB/ SwissProt IDQ6LXC8
NCBI Ref SeqWP_011171368.1
UniProtKB Sequence>tr|Q6LXC8|Q6LXC8_METMP Oligosaccharyl transferase, STT3 subunit OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1424 PE=4 SV=1 MGEFLNKVSDFFKKNEKIKIILILLFIGMMSFQIRAQTADMAFTDNSYLQDMFSDDNGRM YLTALDPYYYLRMTENYVNNDYSNVGETTVGIDGENIPYDTIQYAPPGREAGLVSALSIA TVLVYSVWNSIDSTVTIMNAAFWVPAIMSIFLGIPVFFIVRRNTASNIGGLVGALLLISS PSLLYKTSAGFSDTPIFEILPLLFIVWMIMEAIHEQENSKKSGIFGGIAAILIGLYPMMW SGWWYAFDITAGFLVLYTAYEYLTKSKNLKNVITTSLITLVGGAILVSLSTGLSGFINWI LSPIGFTVINEATKITGWPNVYMTVSELAIPTVTDIIENSVGNIWLLIAGISGILLSFVS FKHDKQKIDIKYALYLTLWLIATVYAATKGIRFVALMTPALAIGIGIFAGQIENIIKRYE KKVEYILYPVIGILSVITLIKYGGELFNILVPTTYVPIAVYLSIIALLVLAVYKIIDIIS EKEQAVKKVFGILLAFMLVFPSMAAAVPFYTAPTMNNGWMDSLSWIKSETPENSVVTCWW DNGHIYTWATRKMVTFDGGSQNTPRAYWVGHAFSTSDENLSVGILRMLATSGDSAYDDDS ILIKKTGSIKDTVDILNKILPLTRTEAKASLVNNYDLTDAEAEEVLDLTHPKVTNPDYLI TYNRMTSIASVWSMFGNWNFSLPASTENSDREMGYYQQLGGSAQDINGTTVVYIPLQETD SYRVINILEITDSEIKSANAVIDSNNQTSMQSPNFHKLILKVNGNVYEQETNENGDYSEI VRLEKLSDGTYQVYAWVSSKNLEDSIYTKLHFLDGYGLEKISLEKESVDPTSYGIQPGFK VYSVDYGTDYLN
EMBL CDSCAF30980.1
Sequence length852 AA
Subcellular LocationMembrane (Integral component of membrane)
Function in Native Organism 1) AglB is OSTase transfer the tetrasaccharide to the S-layer protein.
String267377.MMP1424.
Glycosyltransferase Information
Glycosylation TypeN- (Asn) linked 
CAZY FamilyGT66
EC Number (BRENDA)2.4.99.18.11922.
Mechanism of Glycan TransferEn bloc
Acceptor specificity Sequon_1Asn-Xaa-Ser
Donor TypeLipid linked sugars
Donor SpecificityDolP-Tetrasaccharide
Accessory GT IDProGT13.1 ProGT13.2 ProGT13.3 ProGT13.4 ProGT13.5 ProGT13.6 ProGT13.7 ProGT13.8 ProGT13.9 ProGT13.10 ProGT13.11 ProGT13.12 ProGT13.13 ProGT13.14 ProGT13.15 ProGT13.16 ProGT13.17 ProGT
Glycan Information
Glycan transferredTetrasaccharide (N-acetylgalactosamine, di-acetylated glucuronic acid, an acetylated and acetamidino-modified mannuronic acid linked to threonine, and a novel terminal sugar [(5S)-2-acetamido-2,4-dideoxy-5-O-methyl-a-L-erythro-hexos-5-ulo-1,5-pyranose]) 
Method of Glycan IndentificationNano-LC-MS/MS
Acceptor Subtrate Information
Acceptor Substrate name FlaB1
ProGPdb ID ProGP259
Acceptor Substrate name FlaB2
ProGPdb ID ProGP260
Acceptor Substrate name FlaB3
ProGPdb ID ProGP258
Litrature
Year Of Validation2006 
Reference Siu, S., Robotham, A., Logan, S. M., Kelly, J. F., Uchida, K., Aizawa, S. I., & Jarrell, K. F. (2015). Evidence that biosynthesis of the second and third sugars of the archaellin tetrasaccharide in the archaeon Methanococcus maripaludis occurs by the same pathway used by Pseudomonas aeruginosa to make a di-N-acetylated sugar. Journal of bacteriology, JB-00040.

Authors Siu, S., Robotham, A., Logan, S. M., Kelly, J. F., Uchida, K., Aizawa, S. I., & Jarrell, K. F.
Research groupsDepartment of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada
Corresponding Author Jarrell, K. F.
ContactsDepartment of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada
Reference VanDyke, D. J., Wu, J., Logan, S. M., Kelly, J. F., Mizuno, S., Aizawa, S. I., & Jarrell, K. F. (2009). Identification of genes involved in the assembly and attachment of a novel flagellin N?linked tetrasaccharide important for motility in the archaeon Methanococcus maripaludis. Molecular microbiology, 72(3), 633-644.

Authors VanDyke, D. J., Wu, J., Logan, S. M., Kelly, J. F., Mizuno, S., Aizawa, S. I., & Jarrell, K. F.
Research groupsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada
Corresponding Author Jarrell, K. F.
ContactsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada