Latest update: September 24, 2018


ProGT14 (Pmt)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT14 (Pmt)
ProGT Pathway
Organism Information
Organism NameCorynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Clinical ImplicationNon-pathogenic
DomainBacteria
PhylumActinobacteria
ClassificationFamily: Corynebacteriaceae
Order: Actinomycetales
Phylum: Actinobacteria
Taxonomic ID (NCBI)196627
Genome Information
Gene BankBX927150
EMBLBX927150
Gene Information
Gene Namepmt (cg1014)
NCBI Gene ID1018883
NCBI Reference SequenceCAF19596
Protein information
Protein NamePmt 
UniProtKB/ SwissProt IDQ8NRZ6
NCBI Ref SeqWP_011013949.1
UniProtKB Sequence>sp|Q8NRZ6|PMT_CORGL Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pmt PE=3 SV=1 MSQALPVRDQGRDQGIFAGTLPPAPPKFKWTRLDTYTWAIIAVFALVTRFTGLSSATASG TPVFDEKHYVPQAWDMVRSWINPITGGIESNPGYGLVVHPPLAKQLEALGEWVFGYTPLG WRIMVAIFGTLTIFAIMAIARRLSGSTMVTFIAGILALADGVLLVSSRFGMLDIFLVFFI TAAAWALIRDHQQMHQRLNDLLLTNGQITKDFGPRFGFRWWRFTTGVFLGLALSVKWSGL YYIAFFGLTSVFLDLWLRKRYGVRRYVTGTLKNDVIPALGSLVIIPALLYIWSWRAWFAS ETSVYRHAKTDGTITEDSILQLFPESIAGWIHYHISVLEFHGSLTTSSGHSHPWDSKPWA WLVSGRPILYFSSTDISCDVGGTCRRMIYLFGTPAIWWLTVPVILWALWSFFARRSRGYV VPLVAFAAGFLPWLAAYDRQMYFFYATALVPFTIIMLALACGELWGRGKMTPTGLTRGSM AVVTYISLVVMMFLAFSPLFYGFVIPDYVYESLMWFPSWR
EMBL CDSBAB98283.1
Sequence length520 AA
Subcellular LocationMembrane (Integral component of membrane)
Function in Native Organism 1) Deletion of the C. glutamicum pmt gene (cg1014) which is involved in the transfer of mannose moiety, caused a complete loss of glycosylation of secreted proteins including the resuscitation-promoting factor 2 (Rpf2).
String196627.cg1014.
Additional Information1) C. glutamicum gene cg1014 is conserved among actinobacteria including recently discovered Mycobacterium tuberculosis which encodes an integral membrane protein homologous to eukaryotic O -mannosyltransferases.
2) Pmt of C. glutamicum is the first representative from nonpathogenic Corynebacterineae family.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGT39
EC Number (BRENDA)2.4.1.-
Donor TypeLipid linked sugars
Donor SpecificityPolyprenol phosphate-Mannose
Accessory GT IDProGT14.1
Glycan Information
Glycan transferredMonosaccharide (Man) 
Method of Glycan IndentificationMALDI-TOF-MS
Acceptor Subtrate Information
Acceptor Substrate name Rpf2
ProGPdb ID ProGP233
Litrature
Year Of Validation2006 
Reference Mahne, M., Tauch, A., Pühler, A., & Kalinowski, J. (2006). The Corynebacterium glutamicum gene pmt encoding a glycosyltransferase related to eukaryotic protein-O-mannosyltransferases is essential for glycosylation of the resuscitation promoting factor (Rpf2) and other secreted proteins. FEMS microbiology letters, 259(2), 226-233.

Authors Mahne, M., Tauch, A., Pühler, A., & Kalinowski, J.
Research groupsInstitute for Genome Research, Center for Biotechnology, Bielefeld, Germany. 
Corresponding Author Kalinowski, J.
ContactsInstitute for Genome Research, Center for Biotechnology, Bielefeld, Germany.