Latest update: September 24, 2018


ProGT17 (PglL)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT17 (PglL)
Organism Information
Organism NameNeisseria meningitidis C311#3
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)122586
Genome Information
Gene BankAE002098
EMBLAE002098
Gene Information
Gene NamepglL (NMB0596)
NCBI Gene ID902711
Protein information
Protein NamePglL 
UniProtKB/ SwissProt IDQ9K0K0
NCBI Ref SeqWP_002244038.1
UniProtKB Sequence>tr|Q9K0K0|Q9K0K0_NEIMB Uncharacterized protein OS=Neisseria meningitidis serogroup B (strain MC58) GN=NMB0596 PE=4 SV=1 MPAETTVSGAHPAAKLPIYILPCFLWIGIVPFTFALKLKPSPDFYHDAAAAAGLIVLLFL TAGKKLFDVKIPAISFLLFAMAAFWYLQARLMNLIYPGMNDIVSWIFILLAVSAWACRSL VAHFGQERIVTLFAWSLLIGSLLQSCIVVIQFAGWEDTPLFQNIIVYSGQGVIGHIGQRN NLGHYLMWGILAAAYLNGQRKIPAALGVICLIMQTAVLGLVNSRTILTYIAAIALILPFW YFRSDKSNRRTMLGIAAAVFLTALFQFSMNTILETFTGIRYETAVERVANGGFTDLPRQI EWNKALAAFQSAPIFGHGWNSFAQQTFLINAEQHNIYDNLLSNLFTHSHNIVLQLLAEMG ISGTLLVAATLLTGIAGLLKRPLTPASLFLICTLAVSMCHSMLEYPLWYVYFLIPFGLML FLSPAEASDGIAFKKAANLGILTASAAIFAGLLHLDWTYTRLVNAFSPATDDSAKTLNRK INELRYISANSPMLSFYADFSLVNFALPEYPETQTWAEEATLKSLKYRPHSATYRIALYL MRQGKVAEAKQWMRATQSYYPYLMPRYADEIRKLPVWAPLLPELLKDCKAFAAAPGHPEA KPCK
EMBL CDSAAF41024.1
Sequence length604 AA
Subcellular LocationMembrane (Integral component of membrane)
Function in Native Organism 1) It transfers the trisaccharide from the undecaprenol carrier to pilin.
String122586.NMB0596.
Potential Application1) In vivo, PglL attaches the variety of glycans to proteins this relaxed specificity can be utilized for glycoengineering novel glycan-based vaccines, therapeutics, and diagnostics tools.
Additional Information1) PglL transfers nucleotide-activated sugar (UDP-diNAcBac) on pilin in vitro.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
EC Number (BRENDA)2.4.1.109
Mechanism of Glycan TransferEn bloc
Donor TypeLipid linked sugars
Donor SpecificityUndPP-Trisaccharide
Accessory GT IDProGT17.1 ProGT17.2 ProGT17.3 ProGT17.4 ProGT17.5 ProGT17.6
Glycan Information
Glycan transferredTrisaccharide (Gal(beta 1-4)Gal(alpha 1-3)2,4-diacetimido-2,4,6-trideoxyhexose). 
Experimental_strategiesIn vitro and In vivo  
Acceptor Subtrate Information
Acceptor Substrate name PilE
ProGPdb ID ProGP99
Litrature
Year Of Validation2006 
Reference Power, P. M., Seib, K. L., & Jennings, M. P. (2006). Pilin glycosylation in Neisseria meningitidis occurs by a similar pathway to wzy-dependent O-antigen biosynthesis in Escherichia coli. Biochemical and biophysical research communications, 347(4), 904-908.

Authors Power, P. M., Seib, K. L., & Jennings, M. P.
Research groupsDepartment of Microbiology, Monash University, Clayton, Australia.
Corresponding Author Jennings, M. P.
ContactsDepartment of Microbiology, Monash University, Clayton, Australia
Reference Musumeci, M. A., Hug, I., Scott, N. E., Ielmini, M. V., Foster, L. J., Wang, P. G., & Feldman, M. F. (2013). In vitro activity of Neisseria meningitidis PglL O-oligosaccharyltransferase with diverse synthetic lipid donors and a UDP-activated sugar. Journal of Biological Chemistry, 288(15), 10578-10587.

Authors Musumeci, M. A., Hug, I., Scott, N. E., Ielmini, M. V., Foster, L. J., Wang, P. G., & Feldman, M. F.
Research groups1 Alberta Glycomics Centre, Department of Biological Sciences, University of Alberta, Edmonton, Alberta T6G 2E9, Canada, 2 Centre for High-Throughput Biology and Department of Biochemistry and Molecular Biology, University of British Columbia, Vancouver, British Columbia V6T 14, Canada. 3 Department of Chemistry, Georgia State University, Atlanta, Georgia 30303
Corresponding Author Feldman, M. F.
Contacts1 Alberta Glycomics Centre, Department of Biological Sciences, University of Alberta, Edmonton, Alberta T6G 2E9, Canada, 2 Centre for High-Throughput Biology and Department of Biochemistry and Molecular Biology, University of British Columbia, Vancouver, British Columbia V6T 14, Canada. 3 Department of Chemistry, Georgia State University, Atlanta, Georgia 30303