Latest update: September 24, 2018


ProGT18 (PseD)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT18 (PseD)
ProGT Pathway
Organism Information
Organism NameCampylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)354242
Genome Information
Gene BankCP000538
EMBLCP000538
Gene Information
Gene NamepseD
NCBI Gene ID905625
NCBI Reference SequenceNC_002163.1.
Protein information
Protein NamePseD 
UniProtKB/ SwissProt IDQ7X518
NCBI Ref SeqWP_009882893.1
UniProtKB Sequence>tr|Q7X518|Q7X518_CAMJJ PseD OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=pseD PE=4 SV=1 MKFNLNQKELFNKNIEALDNIPLKESLKEIKSSKFKLILGKDNLDINLQNTSDNTFLYEN VIDELNTMLNTYNDKYLLYPVLYFYGFGNGILFKALLQNKNHQHIVVFEKDIEIIWTMFH ILDFSNELQKNNLIIINTNILSEFDLLNFYKKANSIFLQFSRIYFLELISNYYERYNEEI LKLNDTILSTIKISIIQYGNDSIDNLMGIKHFIYNLSKLLTHPHSEIFLKKRYKLSDTAI IVSTGPSLTKQLPLLKQYANKATIFCADSAYPILAKHNIKPDYVCMLERDDIVSKCFDND FKEFDKGILFILASVVHKEVIEFLERNNREYMLVPRAYDFFYYLNLAKYFQPIDGMVSVA HMNYWLAKFLSHKNIIFIGQDLAYSKDQSSHAKDFIHEKLHEGHFQKDENLFTSIAYGGK GEVESSYFWKLFREIFEKWISHDNNFINIYNCTEGGARIKGTIEKPFLWACENLLGKDLN KPFPKLNPLNINKQNELMLKAYNKIYKSIYHCKDFNKKLLQEYNEIKELYLTLENLQIEE SKELLNFIIQKIDTIKYQIDDAKNMQDLYEILGPLLVQFELNLARIYVLNPKTPEDSFNK SLIWIKEHLEWIEMIYGHIQAQENALFENIIPLEQKLKERKMQKYLRRIKNANK
EMBL CDSEAQ72667
Sequence length654 AA
Subcellular LocationMembrane (Integral component of membrane)
String354242.Cjejjejuni_010100007025.
Potential Application1) The agents which interfere with the flagellin glycosylation process and inhibit infection has therapeutic potential.
Additional Information1) pseA and pseD mutants glycosylate flagellin with Pse5NAc7NAc but lacking PseAm.
2) Insertional inactivation of pseD, which results in an altered flagellin glycosylation.
3) pseD mutant revealed that the flagellin was no longer glycosylated with Pse5NAc7Am.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferSequential
Accessory GT IDProGT18.1 ProGT18.2 ProGT18.3 ProGT18.4 ProGT18.5 ProGT18.6 ProGT18.7 ProGT18.8 ProGT18.9 ProGT18.10
Glycan Information
Method of Glycan IndentificationLC-MS/MS, FT/ICR, CE-ESMS, HILIC-MS, NMR (cold probe)
Acceptor Subtrate Information
Acceptor Substrate name FlaA
ProGPdb ID ProGP207
Litrature
Year Of Validation2006 
Reference McNally, D. J., Hui, J. P., Aubry, A. J., Mui, K. K., Guerry, P., Brisson, J. R., Logan, S.M. & Soo, E. C. (2006). Functional characterization of the flagellar glycosylation locus in Campylobacter jejuni 81-176 using a focused metabolomics approach. Journal of Biological Chemistry.

Authors McNally, D. J., Hui, J. P., Aubry, A. J., Mui, K. K., Guerry, P., Brisson, J. R., Logan, S.M. & Soo, E. C.
Research groupsNational Research Council, Institute for Biological Sciences, Ottawa, Ontario K1A 0R6, Canada.
Corresponding Author Soo, E. C.
ContactsNational Research Council, Institute for Biological Sciences, Ottawa, Ontario K1A 0R6, Canada.