Latest update: September 24, 2018


ProGT19 (Lgt1)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT19 (Lgt1)
Organism Information
Organism NameLegionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Legionellaceae
Order: Legionellales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Taxonomic ID (NCBI)272624
Genome Information
Gene BankAE017354
EMBLAE017354
Gene Information
Gene Namelgt1 (lpg1368)
NCBI Gene ID19832933
Protein information
Protein NameLgt1 
UniProtKB/ SwissProt IDQ5ZVS2
NCBI Ref SeqWP_010947098.1
UniProtKB Sequence>tr|Q5ZVS2|Q5ZVS2_LEGPH Uncharacterized protein OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lpg1368 PE=1 SV=1 MKARRDQQLSKLRMRFFSALNHTSEIDLQVLFNDLKSILTLDSIEHLKEGSVAYAIIQEL LKQDDAQNKIQSFLHGAIKNVIHPGVIKGLTPDEINWNVAKAYPKYYEHEEFPDVTFGGF KVRDSNEFKFKTNIQTSIWFSIKPDLFMPSKQQEALKRRREQYPGCEIRLIYSSSLLNAE ANRQMKAFARKQNISLIDIDSVKTDSPLYPLLKAELAHLGKGGNPAAASDLCRWIPELFN EGFYVDIDLPVDSSKIVEGHQITGGVPIMLNMGSIISEPIAPHHRRQEAVCMNTDIIAYS NDKRTQKMMDTVARYLKNIYDDPYTALKDTPLAQTAFFNKCQEERKSIFDLRKGLQDAFR SDSLLQLYDFLGADKFKEVFKLKEAQSKYINEHISEFSEKDLLLNLISDKPSEISQHTLD FVKAKAMYIDIAKEHYSAFYKPLVEEISGPGAIYNALGGAGSFTTTHRRLTGPMLPTTPP RVLQVFCDAHDKGPFVSDNIARWQTNVRDLGVLNREGLSWLPSVG
EMBL CDSAAU27450.1
Sequence length525 AA
Subcellular LocationHost cell plasma membrane
String272624.lpg1368.
Additional Information1) Lgt1 monoglycosylate eukaryotic EF1A results in inhibition of eukaryotic protein synthesis and this lead to the death of target cells.
PDB ID 2WZG[A] 2WZF[A] 3JSZ[A] 3JT1[A]
Glycosyltransferase Information
Glycosylation TypeO- (Ser) linked 
CAZY FamilyGT88
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferSequential
Donor TypeNucleotide activated sugars
Donor SpecificityUDP-Glc
Glycan Information
Glycan transferredMonosaccharide (Glc) 
Method of Glycan IndentificationMS and NMR
Experimental_strategiesIn vitro and In vivo  
Acceptor Subtrate Information
Acceptor Substrate name EF1A
Acceptor Substrate name Hsp70 subfamily B suppressor 1 (Hbs1)
Litrature
Year Of Validation2006 
Reference Belyi, Y., Niggeweg, R., Opitz, B., Vogelsgesang, M., Hippenstiel, S., Wilm, M., & Aktories, K. (2006). Legionella pneumophila glucosyltransferase inhibits host elongation factor 1A. Proceedings of the National Academy of Sciences, 103(45), 16953-16958.

Authors Belyi, Y., Niggeweg, R., Opitz, B., Vogelsgesang, M., Hippenstiel, S., Wilm, M., & Aktories, K.
Research groupsGamaleya Research Institute, Ulitsa Gamalei 18, Moscow 123098, Russia.
Corresponding Author Aktories, K.
ContactsGamaleya Research Institute, Ulitsa Gamalei 18, Moscow 123098, Russia.
Reference Belyi, Y., Stahl, M., Sovkova, I., Kaden, P., Luy, B., & Aktories, K. (2009). Region of elongation factor 1A1 involved in substrate recognition by Legionella pneumophila glucosyltransferase LGT1-identification of LGT1 as a retaining glucosyltransferase. Journal of Biological Chemistry, jbc-M109.

Authors Belyi, Y., Stahl, M., Sovkova, I., Kaden, P., Luy, B., & Aktories, K.
Research groupsGamaleya Research Institute, Ulitsa Gamalei 18, Moscow 123098, Russia.
Corresponding Author Aktories, K.
ContactsGamaleya Research Institute, Ulitsa Gamalei 18, Moscow 123098, Russia.
Reference Hurtado-Guerrero, R., Zusman, T., Pathak, S., Ibrahim, A.F., Shepherd, S., Prescott, A., Segal,. & Van Aalten, D. M. (2010). Molecular mechanism of elongation factor 1A inhibition by a Legionella pneumophila glycosyltransferase. Biochemical Journal, 426(3), 281-292.

Authors Hurtado-Guerrero, R., Zusman, T., Pathak, S., Ibrahim, A.F., Shepherd, S., Prescott, A., Segal,. & Van Aalten, D. M.
Research groupsDivision of Molecular Microbiology, College of Life Sciences, University of Dundee, Dundee DD1 5EH, Scotland, UK. 
Corresponding Author Van Aalten, D. M.
ContactsDivision of Molecular Microbiology, College of Life Sciences, University of Dundee, Dundee DD1 5EH, Scotland, UK.