Latest update: September 24, 2018


ProGT20 (GmaR)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT20 (GmaR)
Organism Information
Organism NameListeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Clinical ImplicationPathogenic
DomainBacteria
PhylumFirmicutes
ClassificationFamily: Listeriaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)169963
Genome Information
Gene BankAL591976
EMBLAL591976
Gene Information
Gene Namelmo0688
NCBI Gene ID986281
NCBI Reference SequenceNC_003210.1
Protein information
Protein NameGmaR 
UniProtKB/ SwissProt IDQ8Y949
NCBI Ref SeqNP_464215.1
UniProtKB Sequence>tr|Q8Y949|Q8Y949_LISMO Lmo0688 protein OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0688 PE=4 SV=1 MRPLISICMIVKNEAHILRQSLASFRKFTEEIIIVDTGSTDETKEIAQEFTDFVYDFEWT GNFSDARNFAAKHATGKWILAIDADECLEEESYRKLEKQLKSPTEPIQMAQIISFTGEKG RVTTTNQMARVYKNDGTICFRGVIHEQLEAIDKRPIAAGVAEVKIYHYGYMSEIVEKQDK SDRNLRLLEKEVKNNKNSGFVHFNIGQEMNRLGNKKEALKEFSEAFRLRDHNHYIWAKLS AYHIAELLEQEKRYDESLAIIEEARVIWPNVPEFPLKKANILYVNHQLEDAKEIYQSLLE NTAIDYQPIVLYEATNFMPHKMLGTIYLEEKDYTRAMTHFSKAYAENSSDYGVMFQMIML LSKFHQPKEIFAFMERHHFISSTETGLRLLSMTTQQGYAELSELIVQSLTDVYPPVAEAT EVKIATIRNVFPVISESAILFGVKEELIDAADLCLWHYENPQLPIENVMKNSDVGDIYDF IFENGPRISKKRYLFVLERAIALGKGEFADYLLALRNVYHDSINSHIADLFFQYDFADIA LDFYNIVDADEVTKQGYINLINYLVDADVLDEALAIAERGIDNFSTDFRFYLWAIKIDTE NRANRISEAMDEFPNNRYLAKLLDEVTMLQDTVTNNR
EMBL CDSCAC98766.1.
Sequence length637 AA
Subcellular LocationCytoplasm
Function in Native Organism 1) GmaR is functioning as glycosyltransferase which transfers the GlcNAc to the flagella which are involved in motility.
String169963.lmo0688.
Additional Information1) GmaR is bifunctional O-GlcNAc transferase that transcriptionally regulates expression of its enzymatic substrate FlaA.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGT2
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferSequential
Donor TypeNucleotide activated sugars
Donor SpecificityUDP-GlcNAc
Glycan Information
Glycan transferredMonosaccharide (GlcNAc) 
Method of Glycan IndentificationGC-MS and Western blot
Experimental_strategiesIn vitro and In vivo  
Acceptor Subtrate Information
Acceptor Substrate name FlaA
ProGPdb ID ProGP232
Litrature
Year Of Validation2006 
Reference Shen, A., Kamp, H. D., Gründling, A., & Higgins, D. E. (2006). A bifunctional O-GlcNAc transferase governs flagellar motility through anti-repression. Genes & development, 20(23), 3283-3295.

Authors Shen, A., Kamp, H. D., Gründling, A., & Higgins, D. E.
Research groupsDepartment of Microbiology and Molecular Genetics, Harvard Medical School, Boston, Massachusetts 02115, USA.
Corresponding Author Higgins, D. E.
ContactsDepartment of Microbiology and Molecular Genetics, Harvard Medical School, Boston, Massachusetts 02115, USA.
Reference Kamp, H. D., & Higgins, D. E. (2009). Transcriptional and post?transcriptional regulation of the GmaR antirepressor governs temperature?dependent control of flagellar motility in Listeria monocytogenes. Molecular microbiology, 74(2), 421-435.

Authors Kamp, H. D., & Higgins, D. E.
Research groupsDepartment of Microbiology and Molecular Genetics, Harvard Medical School, Boston, Massachusetts 02115, USA.
Corresponding Author Higgins, D. E.
ContactsDepartment of Microbiology and Molecular Genetics, Harvard Medical School, Boston, Massachusetts 02115, USA.
Reference Kamp, H. D., & Higgins, D. E. (2011). A protein thermometer controls temperature-dependent transcription of flagellar motility genes in Listeria monocytogenes. PLoS pathogens, 7(8), e1002153.

Authors Kamp, H. D., & Higgins, D. E.
Research groupsDepartment of Microbiology and Molecular Genetics, Harvard Medical School, Boston, Massachusetts 02115, USA.
Corresponding Author Higgins, D. E.
ContactsDepartment of Microbiology and Molecular Genetics, Harvard Medical School, Boston, Massachusetts 02115, USA.