Latest update: September 24, 2018


ProGT21 (PglO)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT21 (PglO)
ProGT Pathway
Organism Information
Organism NameNeisseria gonorrhoeae N400
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)242231
Genome Information
Gene BankAE004969
EMBLAE004969
Gene Information
Gene NameNGO0178
NCBI Gene ID3281327
NCBI Reference SequenceAAW88933
Protein information
Protein NamePglO 
UniProtKB/ SwissProt IDQ5FA54
NCBI Ref SeqWP_003690624.1
UniProtKB Sequence>tr|Q5FA54|Q5FA54_NEIG1 Polymerase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=NGO_0178 PE=4 SV=1 MSAETTVSGARPAAKLPIYILPCFLWIGIIPFTFALRLKPSPDFYHDAAAAAGLIVLLFL TAGKKLFDVKIPAISFLLFAMAAFWWLQARLMNLIYPGMNDIASWVFILLAVSAWACKSL VAHYGQERIVTLFAWSLLIGSLLQSCIVVIQFAGWENTPLLQNIIVHRGQGVIGHIGQRN NLGHYLMWGILASAYLNGQRKIPAALGAICLIMQTAVLGLVNSRTILTYIAAIALILPFW YFRSDKSNRRTMLGIAAAVFLTALFQFSMNAILETFTGIRYETAVERVANGGFTDLPRQS EWNKALAAFQSAPIFGHGWNSFAQQTFLINAEQHTIHDNFLSTLFTHSHNIILQLLAEMG ISGTLLVAATLLTGIAGLLKRSLTPASLFLLCALAVSMCHSMLEYPLWYVYFLIPFGLML FLSPAEASDGIAFKKAANLGILTASAAIFAGLLHLDWTYTRLVNSFSPAADDSAKTLNRK INELRYISANSPMLSFYADFSLVNFALPEYPETQTWAEEATLKALKYRPYSATYRIALYL MRQGKVAEAKQWMRATQSYYPYLMPRYADEIRKLPVWAPLLPELLKDCKAFAAAPGHPET KPCK
EMBL CDSAAW88933.1
Sequence length604 AA
Subcellular LocationMembrane (Integral component of membrane)
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferEn bloc
Donor TypeLipid linked sugars
Donor SpecificityUndPP-diNAcBac-Gal
Accessory GT IDProGT21.1 ProGT21.2 ProGT21.3 ProGT21.4 ProGT21.5 ProGT21.6
Glycan Information
Glycan transferreddiNAcBac 
Method of Glycan IndentificationMS/MS, NMR, MALDI
Experimental_strategiesIn vitro and In vivo  
Acceptor Subtrate Information
Acceptor Substrate name Pilin
ProGPdb ID ProGP119
Litrature
Year Of Validation2011 
Reference Jennings, M. P., Jen, F. E. C., Roddam, L. F., Apicella, M. A., & Edwards, J. L. (2011). Neisseria gonorrhoeae pilin glycan contributes to CR3 activation during challenge of primary cervical epithelial cells. Cellular microbiology, 13(6), 885-896.

Authors Jennings, M. P., Jen, F. E. C., Roddam, L. F., Apicella, M. A., & Edwards, J. L.
Research groupsDepartments of Chemistry and Biology, Massachusetts Institute of Technology, Cambridge, Massachusetts 02139, USA.
Corresponding Author Edwards, J. L.
ContactsDepartments of Chemistry and Biology, Massachusetts Institute of Technology, Cambridge, Massachusetts 02139, USA.