Latest update: September 24, 2018


ProGT25 (PglL)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT25 (PglL)
ProGT Pathway
Organism Information
Organism NameNeisseria meningitidis MC58
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)122586
Genome Information
Gene BankAE002098
EMBLAE002098
Gene Information
Gene NamepglL
NCBI Gene ID902711
NCBI Reference SequenceAEK98518.1
Protein information
Protein NamePglL 
UniProtKB/ SwissProt IDG1FG65
NCBI Ref SeqWP_002244038.1
UniProtKB Sequence>tr|G1FG65|G1FG65_NEIME Oligosaccharyltransferase OS=Neisseria meningitidis GN=pglL PE=4 SV=1 MPAETTVSGAHPAAKLPIYILPCFLWIGIVPFTFALKLKPSPDFYHDAAAAAGLIVLLFL TAGKKLFDVKIPAISFLLFAMAAFWYLQARLMNLIYPGMNDIVSWIFILLAVSAWACRSL VAHFGQERIVTLFAWSLLIGSLLQSCIVVIQFAGWEDTPLFQNIIVYSGQGVIGHIGQRN NLGHYLMWGILAAAYLNGQRKIPAALGVICLIMQTAVLGLVNSRTILTYIAAIALILPFW YFRSDKSNRRTMLGIAAAVFLTALFQFSMNTILETFTGIRYETAVERVANGGFTDLPRQI EWNKALAAFQSAPIFGHGWNSFAQQTFLINAEQHNIYDNLLSNLFTHSHNIVLQLLAEMG ISGTLLVAATLLTGIAGLLKRPLTPASLFLICTLAVSMCHSMLEYPLWYVYFLIPFGLML FLSPAEASDGIAFKKAANLGILTASAAIFAGLLHLDWTYTRLVNAFSPATDDSAKTLNRK INELRYISANSPMLSFYADFSLVNFALPEYPETQTWAEEATLKSLKYRPHSATYRIALYL MRQGKVAEAKQWMRATQSYYPYLMPRYADEIRKLPVWAPLLPELLKDCKAFAAAPGHPEA KPCK
EMBL CDSAEK98518.1
Sequence length604 AA
Subcellular LocationMembrane (Integral component of membrane)
Function in Native Organism 1) PglL is OSTase transfer the trisaccharide to the pili protein.
Potential Application1) PgIL has relaxed specificity and can transfer the variety of glycans on acceptor substrate, this non-specific behavior of enzyme can use to design conjugate vaccines.
Additional Information1) PglL has relaxed specificity towards donor sugar and able to transfer oligo- and polysaccharides to pilin.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
EC Number (BRENDA)2.4.1.119
Mechanism of Glycan TransferEn bloc
Donor TypeLipid linked sugars
Donor SpecificityUndPP-Trisaccharide
Accessory GT IDProGT25.1 ProGT25.2 ProGT25.3 ProGT25.4 ProGT25.5
Glycan Information
Glycan transferredTrisaccharide (Gal(beta 1-4)Gal(alpha 1-3)2,4-diacetimido-2,4,6-trideoxyhexose). 
Method of Glycan IndentificationNano LC-ESI-MS and MS/MS
Experimental_strategiesIn vivo 
Acceptor Subtrate Information
Acceptor Substrate name PilE
ProGPdb ID ProGP99
Litrature
Year Of Validation2007 
Reference Faridmoayer, A., Fentabil, M. A., Mills, D. C., Klassen, J. S., & Feldman, M. F. (2007). Functional characterization of bacterial oligosaccharyltransferases involved in O-linked protein glycosylation. Journal of bacteriology, 189(22), 8088-8098.

Authors Faridmoayer, A., Fentabil, M. A., Mills, D. C., Klassen, J. S., & Feldman, M. F.
Research groupsAlberta Ingenuity Centre for Carbohydrate Science, Canada
Corresponding Author Feldman, M. F.
ContactsAlberta Ingenuity Centre for Carbohydrate Science, Canada
Reference Faridmoayer, A., Fentabil, M. A., Haurat, M. F., Yi, W., Woodward, R., Wang, P. G., & Feldman, M. F. (2008). Extreme substrate promiscuity of the Neisseria oligosaccharyl transferase involved in protein O-glycosylation. Journal of Biological Chemistry, 283(50), 34596-34604.

Authors Faridmoayer, A., Fentabil, M. A., Haurat, M. F., Yi, W., Woodward, R., Wang, P. G., & Feldman, M. F.
Research groupsAlberta Ingenuity Centre for Carbohydrate Science, Canada
Corresponding Author Feldman, M. F.
ContactsAlberta Ingenuity Centre for Carbohydrate Science, Canada
Reference Faridmoayer, A., Fentabil, M. A., Haurat, M. F., Yi, W., Woodward, R., Wang, P. G., & Feldman, M. F. (2008). Extreme substrate promiscuity of the Neisseria oligosaccharyl transferase involved in protein O-glycosylation. Journal of Biological Chemistry, 283(50), 34596-34604.

Authors Faridmoayer, A., Fentabil, M. A., Haurat, M. F., Yi, W., Woodward, R., Wang, P. G., & Feldman, M. F.
Research groupsAlberta Ingenuity Centre for Carbohydrate Science, Canada
Corresponding Author Feldman, M. F.
ContactsDepartment of Biological Sciences, Duquesne University, Pittsburgh, PA 15282, USA.