Latest update: September 24, 2018


ProGT26 (TfpW)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT26 (TfpW)
Organism Information
Organism NamePseudomonas aeruginosa Pa5196
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)381754
Genome Information
Gene BankAY112720
EMBLAY112720
Gene Information
Protein information
Protein NameTfpW  
UniProtKB/ SwissProt IDQ8KQ31
NCBI Ref Seq AAM52060.1
UniProtKB Sequence>tr|Q8KQ31|Q8KQ31_PSEAI Putative arabinosyltransferase TfpW OS=Pseudomonas aeruginosa PE=4 SV=1 MKSLWVYLQGGGKKNVLLWVGVLCAVVWGLYGRALFFGYVWDDSILFLDKTDLLNSSISW KVLSEPVLPGTSYLRPLVFLSFFVEFQIFGQSPFVSHAVNIAIFNLNVLLVFWLGSTLAR HTERKYGLLLAFLAALFYAMHPALIESTVWASGRFDLLTTFFILAGLVVYLADIKSTVLR AFLLCLCMAGALLSKELGIVFPVLLLCLWLAKECDCSTQRGGALLVQALFRNGWMLVALI ITAFGYLVVRKHSAGGIYHSPVGLSYIADVVLGQRLPLETLKFYLLQSFLPFQSINVSHP LNEVFERSVYVLLAGQMVVLILVLTVIYQALYRRSAAAWMFFAYLVCLLPVLHIIPLTIG ENLGHERFLTAPLAFLALALVFVRYDRVLSKVGLSGAPLLRVGLVAGLLWLGMAGFTIYS ILPMWTSDASLWAWAYKTHPESKYARYDYLYGALRGGYVELLDKEVSRLQKKYGGLEVPE QILYAHRLISAGDSEGLNYLEGVLQVLPRFHDAENGRVALNDFKHLSSMQIGGAYAVYAE GLSMLRGDAERALKYNKIAEWYLATGEVIPLMYQRSAILYALGDYGQAARIYQDQEGLHY YMSQAVKKDMKRLVEGFCKEKGFPSDPCGELRERGVISKESEARQG
Sequence length646 AA
Subcellular LocationMembrane (Integral component of membrane)
Function in Native Organism 1) TfpW transfer a D-Araf of a trisaccharide to the pilin protein.
Potential Application1) Study of D-Araf biosynthesis pathways may help in the identification of the new class of antibiotics against Corynebacterineae.
Additional Information1) TfpW is the first reported gram-negative member of the GT-C glycosyltransferase family which is involved in type IV pilin glycosylation.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGTNC
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferEn bloc
Glycan Information
Glycan transferredAlpha1,5-D-Araf 
Method of Glycan IndentificationETD-MS, and ESI-MS
Experimental_strategiesIn vivo 
Acceptor Subtrate Information
Acceptor Substrate name PilA
ProGPdb ID ProGP230
Litrature
Year Of Validation2008 
Reference Kus, J. V., Kelly, J., Tessier, L., Harvey, H., Cvitkovitch, D. G., & Burrows, L. L. (2008). Modification of Pseudomonas aeruginosa Pa5196 type IV pilins at multiple sites with D-Araf by a novel GT-C family arabinosyltransferase, TfpW. Journal of bacteriology, 190(22), 7464-7478.

Authors Kus, J. V., Kelly, J., Tessier, L., Harvey, H., Cvitkovitch, D. G., & Burrows, L. L.
Research groupsFaculty of Dentistry, University of Toronto, Toronto, Ontario, Canada
Corresponding Author Burrows, L. L.
ContactsFaculty of Dentistry, University of Toronto, Toronto, Ontario, Canada
Reference Harvey, H., Kus, J. V., Tessier, L., Kelly, J., & Burrows, L. L. (2011). The Pseudomonas aeruginosa D-Arabinofuranose biosynthetic pathway and its role in type IV pilus assembly. Journal of Biological Chemistry, jbc-M111.

Authors Harvey, H., Kus, J. V., Tessier, L., Kelly, J., & Burrows, L. L.
Research groupsMichael G DeGroote Institute for Infectious Diseases Research and the Department of Biochemistry and Biomedical Sciences, McMaster University, Hamilton, Ontario L8N 3Z5, Canada.
Corresponding Author Burrows, L. L.
ContactsMichael G DeGroote Institute for Infectious Diseases Research and the Department of Biochemistry and Biomedical Sciences, McMaster University, Hamilton, Ontario L8N 3Z5, Canada.