Latest update: September 24, 2018


ProGT28 (Lgt3)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT28 (Lgt3)
Organism Information
Organism NameLegionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Clinical ImplicationPathogenic
DomainBacteria
PhylumFirmicutes
ClassificationFamily: Legionellaceae
Order: Legionellales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Taxonomic ID (NCBI)272624
Genome Information
Gene BankAE017354
EMBLAE017354
Gene Information
Gene Namelgt3
Protein information
Protein NameLgt3 
UniProtKB/ SwissProt IDQ5ZVF2
NCBI Ref SeqWP_010947217.1
UniProtKB Sequence>tr|Q5ZVF2|Q5ZVF2_LEGPH Coiled-coil-containing protein OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=legC5 PE=4 SV=1 MKEQQKAIFIENIKSTCAVDEQMAKELADSLLEIHQLNTGVNEQTLINEVFLTKFALYLK IGKEVALDWVRKNKDLDTPFPSNTVENQPAQDAKKPVENKVQVYGAMTVGSSPVNKTLNR LTNDLLKEVVERGKTQKAQKLRAYIFDQLARRLEASLSQEQINDLYNRIRGTGDYTKSES FSEEQLKILKEKVVPELKRELSDLSNGNVNILGLDVSREDKYAFDTTNIFSVWFSNNPAV YMPQHVKTQVEKTAKLNQPGKTRIVFSSLCLNETAQIDFQQWAKENNIELVDIDSIDLKS VSETDAQLLNLAKDELGAMRKGKGGNPAAASDLVRWVDVIIGESSTYIDIDLPMNDKKVT VEVHSGFPVLLNMGSALTKDGQQPAMENPAFNTDMIAYSKDKEARRQIIEGVAKKIIARY ENCAKYIEESKNEELVRLKNSPGYKLFVEKTDGKFDLCTLRAAVSEAHQDALSFATFFGA EYFAKTFATQELIPVIKEAIQHQNQDLLTSVIENHIEKQHLNDYPKTPDGIKKLLKSFQG IVYKPLVMEFSGPSAVSSSWVEAISGRSIPRNFEYLAEPMSQPLRVLQHYACVSGKANFS SDNIPKWCELQSDVEKRQQQREDGLSWLPDAQEKLKREGQQAKLEEEQRIKLEEEQRIKL EEEQRIKLEEEQRIKLEEEQRIKLEEEQRIKLEEEQRIKLEEEQRIKLEEEQRIKLEEEH KSKKYFAQSDAIDLILNNFENEINSIGAYYAPAKQRAIELLDTLRKYKEEAFNDPSREKL ISFAQSTKRAIQEATPILQKDLGWGDYLTNLAKQLVNAVTFAVAYAVTFGTTGHQGFFAL KSSLAVSQSQNLEGAINSELSQKNC
EMBL CDSAAU27570.1
Sequence length865 AA
Subcellular LocationHost cell plasma membrane
String272624.lpg1488.
Glycosyltransferase Information
Glycosylation TypeO- (Ser) linked 
CAZY FamilyGT88
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferSequential
Donor TypeNucleotide activated sugars
Donor SpecificityUDP-Glc
Glycan Information
Glycan transferredMonosaccharide (Glc) 
Method of Glycan IndentificationImmunoblot using anti-Lgt serum
Experimental_strategiesIn vitro and In vivo  
Acceptor Subtrate Information
Acceptor Substrate name EF1A
Litrature
Year Of Validation2008 
Reference Belyi, Y., Tabakova, I., Stahl, M., & Aktories, K. (2008). Lgt: a family of cytotoxic glucosyltransferases produced by Legionella pneumophila. Journal of bacteriology, 190(8), 3026-3035.

Authors Belyi, Y., Tabakova, I., Stahl, M., & Aktories, K.
Research groupsGamaleya Research Institute, Moscow 123098, Russia.
Corresponding Author Aktories, K.
ContactsGamaleya Research Institute, Moscow 123098, Russia.
Reference Hurtado-Guerrero, R., Zusman, T., Pathak, S., Ibrahim, A.F., Shepherd, S., Prescott, A., Segal, G. & Van Aalten, D. M. (2010). Molecular mechanism of elongation factor 1A inhibition by a Legionella pneumophila glycosyltransferase. Biochemical Journal, 426(3), 281-292

Authors Hurtado-Guerrero, R., Zusman, T., Pathak, S., Ibrahim, A.F., Shepherd, S., Prescott, A., Segal, G. & Van Aalten, D. M.
Research groupsDivision of Molecular Microbiology, College of Life Sciences, University of Dundee, Dundee DD1 5EH, Scotland, UK. 
Corresponding Author Van Aalten, D. M.
ContactsDivision of Molecular Microbiology, College of Life Sciences, University of Dundee, Dundee DD1 5EH, Scotland, UK.