Latest update: September 24, 2018


ProGT29 (Gap1)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT29 (Gap1)
ProGT Pathway
Organism Information
Organism NameStreptococcus parasanguinis FW213
Clinical ImplicationPathogenic
DomainBacteria
PhylumFirmicutes
ClassificationFamily: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)1114965
Genome Information
Gene BankCP003122.1
EMBLCP003122.1
Gene Information
Gene Namegap1
Protein information
Protein NameGap1 
UniProtKB/ SwissProt IDI1ZP97
NCBI Ref SeqWP_014713993.1
UniProtKB Sequence>tr|I1ZP97|I1ZP97_STRPA Glycosylation associated protein, mature Fap1 export and glycosylation,gap1 OS=Streptococcus parasanguinis FW213 GN=gap1 PE=4 SV=1 MFYFVPSWYNGQRQWYYDTPWWFRVKNRMTFDDSVNQVKMFLQGQEEIGLMILNYQPQLR YFLHKQNIFGIYYWSFFDDIQNITRSYTKIIHLKDLNWPEGCEFLYSPFAVVVRLKGEIF AIVNYAEDGNLHSVSFQKNGKVTKDYIFDDRGFLSSILYYDIDERPLYQDYLNINGVWQV REFLKKENDPTPILMINDFSDQTFSKKYYNGWEELIKERLAIFQNNHVENEDVFVLASDT QHNQLVSSIFKEHRKIYSFFGNRFNLENLGQDRISINDATFLVVDTEKNEELLRKTCENL VFKSIPIVRLSPFDSRLRLGHSQTVKEQIIYFHIDNIELDELYSVIAIILELMTLHLDIE LRIVTFRQDFQLDLLKTWIIDFIKTNHFEDLLFKQISEGENEIEDEGEIELSRIAMECFT NENQIIKCLDTARLVIDLGIEPDLYTQIASISAGIPQINRVSSDYVIHQKNGLVISDISK LSSAIEFYFDGLFNWNEALIYAVRKMSDYTSGKILKQWKGMLKKK
EMBL CDSAFJ26871.1
Sequence length525 AA
Additional Information1) The Gap1-Gap3 interaction is required for Fap1-dependent bacterial adhesion.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferSequential
Accessory GT IDProGT29.1ProGT29.2
Glycan Information
Method of Glycan IndentificationGC-MS
Experimental_strategiesIn vivo and In vitro 
Acceptor Subtrate Information
Acceptor Substrate name Fap1
ProGPdb ID ProGP209
Litrature
Year Of Validation2008 
Reference Li, Y., Chen, Y., Huang, X., Zhou, M., Wu, R., Dong, S., Pritchard, D.G., Fives?Taylor, P. & Wu, H. (2008). A conserved domain of previously unknown function in Gap1 mediates protein–protein interaction and is required for biogenesis of a serine?rich streptococcal adhesin. Molecular microbiology, 70(5), 1094-1104.

Authors Li, Y., Chen, Y., Huang, X., Zhou, M., Wu, R., Dong, S., Pritchard, D.G., Fives?Taylor, P. & Wu, H.
Research groupsDepartment of Pediatric Dentistry, Schools of Dentistry and Medicine, University of Alabama, Birmingham, AL 35294, USA.
Corresponding Author Wu, H.
ContactsDepartment of Pediatric Dentistry, Schools of Dentistry and Medicine, University of Alabama, Birmingham, AL 35294, USA.
Reference Zhou, M., Zhang, H., Zhu, F., & Wu, H. (2011). Canonical SecA associates with an accessory secretory protein complex involved in biogenesis of a streptococcal serine-rich repeat glycoprotein. Journal of bacteriology, JB-05668.

Authors Zhou, M., Zhang, H., Zhu, F., & Wu, H.
Research groupsDepartment of Pediatric Dentistry, Schools of Dentistry and Medicine, University of Alabama, Birmingham, AL 35294, USA.
Corresponding Author Wu, H.
ContactsDepartment of Pediatric Dentistry, Schools of Dentistry and Medicine, University of Alabama, Birmingham, AL 35294, USA.